Lus10019173 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT2G03720 184 / 3e-59 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT5G17390 162 / 2e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G03290 155 / 1e-46 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G44760 110 / 7e-30 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT4G13450 80 / 4e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT1G48960 60 / 8e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G11360 49 / 6e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
AT2G21620 48 / 7e-07 RD2 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT1G68300 48 / 8e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036814 181 / 5e-59 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10034661 171 / 4e-53 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10007982 163 / 9e-50 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10025644 106 / 1e-28 AT1G44760 211 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10018190 100 / 3e-26 AT1G44760 197 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10029664 99 / 1e-25 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10042701 99 / 2e-25 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10014459 81 / 1e-18 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10023716 59 / 3e-11 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G140200 277 / 7e-95 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.008G109000 268 / 4e-91 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.T170801 267 / 7e-91 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.015G060700 201 / 6e-65 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.002G084600 120 / 1e-33 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.005G177100 114 / 3e-31 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.010G064800 89 / 1e-21 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.012G059100 51 / 1e-07 AT1G48960 175 / 3e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.010G123200 50 / 2e-07 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.011G039800 50 / 3e-07 AT1G11360 269 / 3e-91 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10019173 pacid=23141769 polypeptide=Lus10019173 locus=Lus10019173.g ID=Lus10019173.BGIv1.0 annot-version=v1.0
ATGGGTGCAAAGACAGCAGCAGCAGGGGGGTTCTGCCTCAACCGCATCCGCCCACACGTCAGAGTAGTCCGGTCCCCGCAGCAACCTGACCGGCCGAAAC
TAGATGATCATGACGGCGGAGGTAAAACTACGCCGACTGAGGCGGTGGCGATCGGAGGAGGAGGAAGGAAGGTGATGATAGTGGTGGATTCGAGCGCGGA
GGCTAAGGTTGCTCTGCAGTGGGCGCTTTCCCATACTGTTCAAGTGCAGGACACTCTGCTTCTTCTCCATGTTGCCAAGCCATCTAACAACCATGGCCAC
CAAGGGTTGATGAAAGGAAGAGGTTCAAGAGGTTATGAGCTGGCCAACTCTCTAAAGAAAATGAGCCAGATGAAGAGGCCAGAGGTGGAGATAGAGACAG
TAATAGTGGAAGGGAAGGAGAAAGGTCCAACAATAGTTGAAGAAGCAAAGAAGCAAGGCGTAGCTCTGCTGGTACTTGGCCAGAGGAAGAGATCTTCGAT
GACGTGGCGGCTGATCATGATGTGGGCCAGTAGTAAAGTCAATGCAGCCGGCGGCGGCGGGGTGGTGGAGTATTGTATCCAGAATGCAGAGTGCATGGCG
ATCGCCGTCCGGCGGAAGAGCAAGAAACATGGCGGCTACTTGATCACCACTAAACGCCATAAGGATTTCTGGCTCTTAGCCTAG
AA sequence
>Lus10019173 pacid=23141769 polypeptide=Lus10019173 locus=Lus10019173.g ID=Lus10019173.BGIv1.0 annot-version=v1.0
MGAKTAAAGGFCLNRIRPHVRVVRSPQQPDRPKLDDHDGGGKTTPTEAVAIGGGGRKVMIVVDSSAEAKVALQWALSHTVQVQDTLLLLHVAKPSNNHGH
QGLMKGRGSRGYELANSLKKMSQMKRPEVEIETVIVEGKEKGPTIVEEAKKQGVALLVLGQRKRSSMTWRLIMMWASSKVNAAGGGGVVEYCIQNAECMA
IAVRRKSKKHGGYLITTKRHKDFWLLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69080 Adenine nucleotide alpha hydro... Lus10019173 0 1
AT3G54030 Protein kinase protein with te... Lus10021112 8.7 0.7523
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Lus10007748 10.1 0.7319
AT1G04360 RING/U-box superfamily protein... Lus10024881 13.4 0.6914
AT3G44510 alpha/beta-Hydrolases superfam... Lus10004879 20.4 0.6348
AT2G40820 unknown protein Lus10027293 23.7 0.7172
AT1G04360 RING/U-box superfamily protein... Lus10000710 24.2 0.6719
AT2G40820 unknown protein Lus10038998 24.8 0.7226
AT5G62550 unknown protein Lus10024245 26.4 0.7044
AT4G18260 Cytochrome b561/ferric reducta... Lus10020757 27.5 0.6710
AT1G69160 unknown protein Lus10019172 32.0 0.7047

Lus10019173 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.