Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14630 164 / 6e-48 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT3G14610 163 / 1e-47 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14690 161 / 8e-47 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT3G14680 161 / 9e-47 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT2G46960 156 / 8e-46 CYP709B1 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) AT3G14660 157 / 3e-45 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14620 154 / 3e-44 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT2G26710 154 / 4e-44 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT4G27710 153 / 1e-43 CYP709B3 "cytochrome P450, family 709, subfamily B, polypeptide 3", cytochrome P450, family 709, subfamily B, polypeptide 3 (.1) AT3G14650 152 / 4e-43 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019177 [exp] 370 / 2e-127 AT2G26710 373 / 4e-124 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036817 [exp] 367 / 1e-120 AT2G26710 382 / 3e-121 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036818 [exp] 327 / 1e-110 AT2G26710 369 / 2e-122 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10019175 [exp] 256 / 5e-84 AT3G14620 318 / 1e-103 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10036816 [exp] 238 / 6e-76 AT3G14620 339 / 8e-111 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10019176 [exp] 235 / 6e-75 AT3G14620 342 / 8e-112 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10019184 [exp] 232 / 7e-74 AT3G14680 369 / 2e-122 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) Lus10026084 [exp] 223 / 5e-70 AT2G26710 375 / 6e-125 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026085 [exp] 220 / 4e-69 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G139600 [exp] 242 / 1e-77 AT2G26710 395 / 6e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G071200 [exp] 224 / 1e-70 AT2G26710 346 / 9e-114 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139200 [exp] 220 / 3e-69 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139400 [exp] 207 / 3e-64 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139300 [exp] 206 / 7e-64 AT2G26710 372 / 1e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G014407 [exp] 203 / 1e-62 AT2G26710 389 / 3e-130 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.011G099200 [exp] 162 / 1e-48 AT3G14660 466 / 3e-163 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) Potri.011G098800 [exp] 164 / 5e-48 AT3G14690 640 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099400 [exp] 157 / 3e-45 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101700 [exp] 156 / 6e-45 AT3G14690 606 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10019178 pacid=23141746 polypeptide=Lus10019178 locus=Lus10019178.g ID=Lus10019178.BGIv1.0 annot-version=v1.0 ATGTTCAAGAGTAAAGACGACATTGAAGGCGAGAGGCTGGACAAGGGGATAAGGGACTCCATAATGAAGATAGTGACAAAGAGGCAGGAGAAGGTGAAGA GTGGAGATATGAAAGGGTATGGGGACGATTATCTCAGGATGTTGATAAGGTCTTACAATGAGCAAGACGAATCAAGGAGGATCGATCTTGATCATTTGAT CAATGAATGCAAAACATTGTATGTTGCCGGACAGGAAACGACCAATTCTTTGCTTTCTTGGATCGTTTTCCTTCTATCAATCCATCAGGATTGGCAAGAC GAGGCAAGAAAAGAGGTCGTTGGCATATTTGGCCGCGACTGGAATCCTGATGCTGATGGGATTTCCAGACTCAAAGTGGCGAGTATGATCATGAACGAAA CGCTAAGGCTCTATTCGCCAGTGTACTCGTCCTTCATGCGCAATATCAACGAGGATGTGACATTGGGGAAGCTCAAGGTGCCTGCAGGAGTACAATTTCA CGTACCGTTCATGTCCGTCCACCATGACTCTGAGATATGGGGAGAAGATGTATATCTTTTCAAACCGGATAGATTTGCGGAAGCAGTTGTCAAGGCTACA ACAACAACCCGGCTGCATTCATACCCTTCGCGATGGGGCCTCACATTTGTACAGGATACAACTTAG
AA sequence Show only first row Show all	>Lus10019178 pacid=23141746 polypeptide=Lus10019178 locus=Lus10019178.g ID=Lus10019178.BGIv1.0 annot-version=v1.0 MFKSKDDIEGERLDKGIRDSIMKIVTKRQEKVKSGDMKGYGDDYLRMLIRSYNEQDESRRIDLDHLINECKTLYVAGQETTNSLLSWIVFLLSIHQDWQD EARKEVVGIFGRDWNPDADGISRLKVASMIMNETLRLYSPVYSSFMRNINEDVTLGKLKVPAGVQFHVPFMSVHHDSEIWGEDVYLFKPDRFAEAVVKAT TTTRLHSYPSRWGLTFVQDTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14630		CYP72A9	"cytochrome P450, family 72, s...		Lus10019178 [exp]	0	1
AT4G13830		J20	DNAJ-like 20 (.1.2)		Lus10019668 [exp]	1.0	0.8134
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10037090 [exp]	1.4	0.8112
AT1G55790			Domain of unknown function (DU...		Lus10032900 [exp]	8.5	0.7421
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10005599 [exp]	10.6	0.6901
AT1G18100		MFT, E12A11	MOTHER OF FT AND TFL1, PEBP (p...		Lus10029233 [exp]	16.5	0.6723
					Lus10014629 [exp]	22.7	0.6499
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	25.9	0.6431
AT2G26490			Transducin/WD40 repeat-like su...		Lus10016289 [exp]	26.8	0.6431
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10017997 [exp]	27.7	0.6431
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10008372 [exp]	28.6	0.6431

Compare expression of checked genes

Lus10019178 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.