Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02610 156 / 2e-50 Ribosomal L29 family protein (.1.2) AT2G39390 155 / 3e-50 Ribosomal L29 family protein (.1) AT3G09500 154 / 1e-49 Ribosomal L29 family protein (.1) AT3G55170 151 / 2e-48 Ribosomal L29 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003306 [exp] 168 / 3e-55 AT3G09500 218 / 6e-75 Ribosomal L29 family protein (.1) Lus10030314 [exp] 166 / 2e-54 AT3G09500 214 / 2e-73 Ribosomal L29 family protein (.1) Lus10023449 [exp] 164 / 2e-53 AT5G02610 209 / 5e-71 Ribosomal L29 family protein (.1.2) Lus10025292 [exp] 161 / 2e-52 AT5G02610 221 / 5e-76 Ribosomal L29 family protein (.1.2) Lus10024437 [exp] 155 / 5e-50 AT5G02610 218 / 6e-75 Ribosomal L29 family protein (.1.2) Lus10019180 [exp] 121 / 8e-37 AT5G02610 172 / 4e-57 Ribosomal L29 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G212300 [exp] 162 / 8e-53 AT2G39390 213 / 4e-73 Ribosomal L29 family protein (.1) Potri.006G214200 [exp] 159 / 9e-52 AT2G39390 186 / 3e-62 Ribosomal L29 family protein (.1) Potri.008G048800 [exp] 158 / 2e-51 AT5G02610 177 / 1e-58 Ribosomal L29 family protein (.1.2) Potri.006G214100 [exp] 156 / 1e-50 AT2G39390 189 / 2e-63 Ribosomal L29 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0346 [flax] [poplar] Ribo_L29 PF00831 [flax] [poplar] Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence Show only first row Show all	>Lus10019179 pacid=23141794 polypeptide=Lus10019179 locus=Lus10019179.g ID=Lus10019179.BGIv1.0 annot-version=v1.0 ATGGCCAGAATCAAGGTCCACGAGCTGAGGCAGAAGAACAAGTTGGATCTTTTGAATCAGCTCAAGGATCTCAAGGCTGAGTTTTCTCTTCTCCGCGTTG CCAAGGTCACCGGCGGCGCTCCTAACAAGCTCTCCAAGATCAAGGTGGTGCGGCTGTCTATTGCCCAAGTGCAGACTGTCATCTCACAGAAGCAGAAAGC TGCACTTCGTGAAGTGTACAAGAACAAGAAGCTGTTGCCTCTTGACCTCCGTCCCAAGAAGACCAGAGCCATCAGAAGGAGGCTTACCAAGCACCAGCAA TCTCTTAAGACGGAGAGGGAGAAGAAGAGGGAAATGTACTTCCCCATGAGGAAGTATGCAATCAAGGTGTAG
AA sequence Show only first row Show all	>Lus10019179 pacid=23141794 polypeptide=Lus10019179 locus=Lus10019179.g ID=Lus10019179.BGIv1.0 annot-version=v1.0 MARIKVHELRQKNKLDLLNQLKDLKAEFSLLRVAKVTGGAPNKLSKIKVVRLSIAQVQTVISQKQKAALREVYKNKKLLPLDLRPKKTRAIRRRLTKHQQ SLKTEREKKREMYFPMRKYAIKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02610			Ribosomal L29 family protein ...		Lus10019179 [exp]	0	1
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Lus10022057 [exp]	2.8	0.9597
AT4G14320			Zinc-binding ribosomal protein...		Lus10038130 [exp]	3.2	0.9577
AT2G43650		EMB2777	EMBRYO DEFECTIVE 2777, Sas10/U...		Lus10027922 [exp]	3.3	0.9437
AT5G13960		SDG33, KYP, SUV...	SET DOMAIN PROTEIN 33, KRYPTON...		Lus10002571 [exp]	4.0	0.9375
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10014676 [exp]	4.0	0.9554
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10001681 [exp]	5.5	0.9563
AT1G41880			Ribosomal protein L35Ae family...		Lus10028254 [exp]	5.9	0.9532
AT5G26800			unknown protein		Lus10015444 [exp]	6.4	0.9191
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10035584 [exp]	6.7	0.9536
AT2G20450			Ribosomal protein L14 (.1)		Lus10021170 [exp]	8.5	0.9514

Compare expression of checked genes

Lus10019179 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.