Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02610 117 / 2e-35 Ribosomal L29 family protein (.1.2) AT2G39390 116 / 4e-35 Ribosomal L29 family protein (.1) AT3G09500 115 / 2e-34 Ribosomal L29 family protein (.1) AT3G55170 112 / 2e-33 Ribosomal L29 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003306 [exp] 122 / 3e-37 AT3G09500 218 / 6e-75 Ribosomal L29 family protein (.1) Lus10030314 [exp] 122 / 4e-37 AT3G09500 214 / 2e-73 Ribosomal L29 family protein (.1) Lus10025292 [exp] 121 / 9e-37 AT5G02610 221 / 5e-76 Ribosomal L29 family protein (.1.2) Lus10019179 [exp] 120 / 3e-36 AT5G02610 210 / 7e-72 Ribosomal L29 family protein (.1.2) Lus10023449 [exp] 119 / 1e-35 AT5G02610 209 / 5e-71 Ribosomal L29 family protein (.1.2) Lus10024437 [exp] 115 / 2e-34 AT5G02610 218 / 6e-75 Ribosomal L29 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G214200 [exp] 120 / 1e-36 AT2G39390 186 / 3e-62 Ribosomal L29 family protein (.1) Potri.010G212300 [exp] 119 / 7e-36 AT2G39390 213 / 4e-73 Ribosomal L29 family protein (.1) Potri.006G214100 [exp] 118 / 1e-35 AT2G39390 189 / 2e-63 Ribosomal L29 family protein (.1) Potri.008G048800 [exp] 117 / 2e-35 AT5G02610 177 / 1e-58 Ribosomal L29 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0346 [flax] [poplar] Ribo_L29 PF00831 [flax] [poplar] Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence Show only first row Show all	>Lus10019180 pacid=23141739 polypeptide=Lus10019180 locus=Lus10019180.g ID=Lus10019180.BGIv1.0 annot-version=v1.0 ATGGCCAGAATCAAGGTCCACGAGCTGAGGCAGAAGAACAAGTTGGATCTTTTGAATCAGCTCAAGGATCTCAAGGCTGAGCTTTCTCTTCTCCGCGTCG CCAAGGTCACAGGCGGCGCTCCTAACAAGCTCTCCAAGATCAAGGTGGTGCGGTTGTCTATTGCCCAAGTGTTGACAGTGATCTCACAGAAGCAGAAAGC TGCACTTCGTGAAGTGTACAAGAACAAGAAGCTGTTGCCTCTTGACCTCCGTCCCAAGAAGACCAGAGCCATCAGAAGGAGGCTTACCAAGCACCAGGTA GTTCCTTTTTCCACTCTGGGATGA
AA sequence Show only first row Show all	>Lus10019180 pacid=23141739 polypeptide=Lus10019180 locus=Lus10019180.g ID=Lus10019180.BGIv1.0 annot-version=v1.0 MARIKVHELRQKNKLDLLNQLKDLKAELSLLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAALREVYKNKKLLPLDLRPKKTRAIRRRLTKHQV VPFSTLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02610			Ribosomal L29 family protein ...		Lus10019180 [exp]	0	1
AT1G55900		TIM50, EMB1860	embryo defective 1860, Haloaci...		Lus10016610 [exp]	2.4	0.8256
AT4G27090			Ribosomal protein L14 (.1)		Lus10003627 [exp]	3.9	0.8161
AT5G56670			Ribosomal protein S30 family p...		Lus10028808 [exp]	4.2	0.8273
AT3G52570			alpha/beta-Hydrolases superfam...		Lus10021315 [exp]	5.7	0.8361
AT3G61415		ASK21	SKP1-like 21 (.1.2)		Lus10014770 [exp]	7.3	0.7803
AT3G54200			Late embryogenesis abundant (L...		Lus10040941 [exp]	8.8	0.8036
AT2G04560		AtLpxB	lipid X B, transferases, trans...		Lus10029959 [exp]	13.7	0.7809
AT5G11200			DEAD/DEAH box RNA helicase fam...		Lus10002905 [exp]	14.7	0.8084
AT1G63780		IMP4	Ribosomal RNA processing Brix ...		Lus10035745 [exp]	17.2	0.7950
AT2G34160			Alba DNA/RNA-binding protein (...		Lus10002027 [exp]	18.1	0.8177

Compare expression of checked genes

Lus10019180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.