Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26710 65 / 2e-13 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT3G14620 57 / 2e-10 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT2G46960 51 / 1e-08 CYP709B1 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) AT3G14640 50 / 4e-08 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT3G14660 50 / 4e-08 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT1G75130 49 / 7e-08 CYP721A1 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) AT3G14690 48 / 2e-07 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT3G14680 48 / 2e-07 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14650 45 / 1e-06 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1) AT3G14610 45 / 2e-06 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036822 [exp] 194 / 2e-60 AT2G26710 410 / 4e-137 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10004633 [exp] 118 / 2e-32 AT2G26710 378 / 4e-126 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026681 [exp] 118 / 3e-32 AT3G14620 322 / 4e-103 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10036820 [exp] 105 / 7e-28 AT2G26710 397 / 2e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10006245 [exp] 99 / 3e-25 AT2G26710 345 / 4e-108 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036942 [exp] 98 / 6e-25 AT2G26710 375 / 2e-119 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026085 [exp] 93 / 3e-23 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) Lus10019184 [exp] 91 / 1e-22 AT3G14680 369 / 2e-122 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) Lus10036818 [exp] 91 / 3e-22 AT2G26710 369 / 2e-122 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G139300 [exp] 118 / 2e-32 AT2G26710 372 / 1e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139400 [exp] 115 / 1e-31 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G071200 [exp] 111 / 5e-30 AT2G26710 346 / 9e-114 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139600 [exp] 108 / 7e-29 AT2G26710 395 / 6e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139500 [exp] 107 / 1e-28 AT3G14620 283 / 4e-90 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.010G139200 [exp] 107 / 2e-28 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.017G000600 [exp] 100 / 3e-26 AT1G17060 166 / 1e-46 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1) Potri.019G014407 [exp] 99 / 1e-25 AT2G26710 389 / 3e-130 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.006G154500 [exp] 58 / 6e-11 AT2G26710 789 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.011G117700 [exp] 57 / 7e-11 AT3G14620 368 / 9e-125 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019182 pacid=23141789 polypeptide=Lus10019182 locus=Lus10019182.g ID=Lus10019182.BGIv1.0 annot-version=v1.0 ATGTTGCTGAGATGGAAATTGGAAGGTGTGAAGGAGATCGATGCCTTCCCGGAGTTCAAGATTTTGTCGTCGGAAGTGATTTCGAGGACAGCGTTCGGAA GTAGTTACTTGGAAGACAAGAAAGTGTTTGAGATGTTAATGAAGTTTGGGATCATTTTCAATAGAAACAACTACAAAATTAGCATCCCTGGGATCAAAAA ATTCTGGAGAACAAGTGACGATGTAGAATCAGACAAGCTCCATAAAGACATTAAAGAAGCAATCATAAAGCTGGTAAACAAAAGGGGAGGTTTGATGGAT GATGGAAGTGGAAGTTATGGAAAATGA
AA sequence Show only first row Show all	>Lus10019182 pacid=23141789 polypeptide=Lus10019182 locus=Lus10019182.g ID=Lus10019182.BGIv1.0 annot-version=v1.0 MLLRWKLEGVKEIDAFPEFKILSSEVISRTAFGSSYLEDKKVFEMLMKFGIIFNRNNYKISIPGIKKFWRTSDDVESDKLHKDIKEAIIKLVNKRGGLMD DGSGSYGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10019182 [exp]	0	1
AT2G27310			F-box family protein (.1)		Lus10013309 [exp]	8.6	0.8149
AT5G44640		BGLU13	beta glucosidase 13 (.1)		Lus10024065 [exp]	9.2	0.7839
AT2G37980			O-fucosyltransferase family pr...		Lus10017190 [exp]	17.9	0.8127
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Lus10034505 [exp]	20.6	0.7944
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10010939 [exp]	24.4	0.7767
AT1G77100			Peroxidase superfamily protein...		Lus10018929 [exp]	26.2	0.7425
AT4G23030			MATE efflux family protein (.1...		Lus10027417 [exp]	43.9	0.7406
					Lus10006091 [exp]	45.8	0.7635
AT1G03230			Eukaryotic aspartyl protease f...		Lus10000080 [exp]	51.2	0.7229
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Lus10010938 [exp]	51.6	0.7430

Compare expression of checked genes

Lus10019182 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.