Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14610 117 / 1e-30 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14640 116 / 3e-30 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT3G14660 116 / 4e-30 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14630 115 / 5e-30 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT3G14690 111 / 2e-28 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT3G14680 109 / 8e-28 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14650 108 / 3e-27 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1) AT3G14620 107 / 8e-27 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT2G26710 100 / 1e-24 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT1G67110 99 / 5e-24 CYP735A2 "cytochrome P450, family 735, subfamily A, polypeptide 2", cytochrome P450, family 735, subfamily A, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036820 [exp] 350 / 5e-120 AT2G26710 397 / 2e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036823 [exp] 275 / 5e-94 AT3G14610 227 / 2e-71 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) Lus10006245 [exp] 269 / 2e-84 AT2G26710 345 / 4e-108 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036942 [exp] 268 / 7e-84 AT2G26710 375 / 2e-119 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036822 [exp] 200 / 1e-60 AT2G26710 410 / 4e-137 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10004633 [exp] 180 / 5e-54 AT2G26710 378 / 4e-126 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026681 [exp] 181 / 1e-53 AT3G14620 322 / 4e-103 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10019184 [exp] 156 / 8e-45 AT3G14680 369 / 2e-122 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) Lus10026085 [exp] 155 / 2e-44 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G139300 [exp] 193 / 4e-59 AT2G26710 372 / 1e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G071200 [exp] 191 / 2e-58 AT2G26710 346 / 9e-114 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139600 [exp] 188 / 5e-57 AT2G26710 395 / 6e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139400 [exp] 183 / 3e-55 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G014407 [exp] 179 / 1e-53 AT2G26710 389 / 3e-130 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139200 [exp] 176 / 2e-52 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139500 [exp] 147 / 4e-42 AT3G14620 283 / 4e-90 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.011G098800 [exp] 116 / 3e-30 AT3G14690 640 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099200 [exp] 112 / 1e-29 AT3G14660 466 / 3e-163 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) Potri.011G099400 [exp] 114 / 2e-29 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10019186 pacid=23141792 polypeptide=Lus10019186 locus=Lus10019186.g ID=Lus10019186.BGIv1.0 annot-version=v1.0 ATGAAGATGGTTTTGATCATCTCACGAAACAACTACAAAGCCCGGATTCCAGGACTCGAATCCTTTTTCAGAACTGGGGATGAGCATGAATCAGCTGTTC TTCAACAAGAGATCAAATCCATCATCATGAACATGGTCATCAAAAGAAAAGAAGAGAATACCAATAGTAGTTCTGCAACTGATTTCCTTGGAATGCTTCT CAAGGCTCATACCGATCCGGATATAAACAACAGCATAACAATGGATGATCTGGTTGATGAATGCAAGACATTCTACGTCTCAGGCCATGAAACCACAACG AGCTCGCTGACCTGGACGCTGACAATGATCATCAATGAATCTCTGAGGCTATACCCTTCAGTGTTACACCTCTCGAGGAAAGTCGAACGAGACCAACTCT TTAGACCTGAAAGATTTGCGGAATCAGGGGTAGTTAAAGCTGCTACATTTCTACCGTTCGTGTTGGGGCCTCGAAACTGTGTAGGTATGAACTTTGCTAT CACGGAAGAGAAGATTGCACTTTCGATGATTTTGCAGCGTTACAGGTTTAGCCTCTCGGACAAGTATGTACACTCGCCCGCTCTGGTTTTGACTAGCTGC CCGAAGCATGGTCTGCAAATTGTTCTGGAGAAACTTTGA
AA sequence Show only first row Show all	>Lus10019186 pacid=23141792 polypeptide=Lus10019186 locus=Lus10019186.g ID=Lus10019186.BGIv1.0 annot-version=v1.0 MKMVLIISRNNYKARIPGLESFFRTGDEHESAVLQQEIKSIIMNMVIKRKEENTNSSSATDFLGMLLKAHTDPDINNSITMDDLVDECKTFYVSGHETTT SSLTWTLTMIINESLRLYPSVLHLSRKVERDQLFRPERFAESGVVKAATFLPFVLGPRNCVGMNFAITEEKIALSMILQRYRFSLSDKYVHSPALVLTSC PKHGLQIVLEKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46950		CYP709B2	"cytochrome P450, family 709, ...		Lus10019186 [exp]	0	1
AT4G02210			unknown protein		Lus10023062 [exp]	1.0	0.8414
AT2G15220			Plant basic secretory protein ...		Lus10019803 [exp]	5.2	0.7857
AT2G02990		RNS1, ATRNS1	ribonuclease 1 (.1)		Lus10030468 [exp]	8.5	0.7828
					Lus10011947 [exp]	9.4	0.8031
AT5G61890	AP2_ERF		Integrase-type DNA-binding sup...		Lus10022426 [exp]	15.3	0.7536
AT3G24310	MYB	MYB305, ATMYB71	MYB DOMAIN PROTEIN 71, myb dom...		Lus10014453 [exp]	27.6	0.7543
AT1G10385			Vps51/Vps67 family (components...		Lus10033648 [exp]	30.6	0.7166
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10010989 [exp]	40.6	0.7533
AT1G09380			nodulin MtN21 /EamA-like trans...		Lus10001523 [exp]	44.4	0.7086
AT1G10385			Vps51/Vps67 family (components...		Lus10017692 [exp]	44.8	0.7041

Compare expression of checked genes

Lus10019186 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.