Lus10019190 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036826 178 / 5e-59 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G138700 50 / 8e-09 AT1G69050 / unknown protein
Potri.008G109150 47 / 8e-08 AT1G69050 49 / 2e-09 unknown protein
Potri.T139662 47 / 8e-08 AT1G69050 49 / 2e-09 unknown protein
PFAM info
Representative CDS sequence
>Lus10019190 pacid=23141820 polypeptide=Lus10019190 locus=Lus10019190.g ID=Lus10019190.BGIv1.0 annot-version=v1.0
ATGGATCATCATAGCTGCGCGACAATGGAGGATCCTCCTCAGCCTGCTACGCCTTCGTTTCCAGGGTTCCAGAGCTCCATGCACAGAGACGAGATGGAGT
ACGAGAGAGTGCTGACTAGGCTACAGAGACGAGCGCCTACTCAGCTTCTTATCGACAATAAGCATATCTTCCCCACCGTTGACTCTGCTTCTGCTACTTA
CCCTTCTCCTCAAACCTGTCCGGCGAGATTCGGGTCTTCATCCGGGTCGGGTTCTTTCAATAAGGGTGGTGGTAAGCAAGATCCGATTCCTCTGCTGACG
CCTCTGGTTTCGCCGACGGCTGCAGGACTGGGACAGCAGATGCAGAAGCAGGGGATTTCTTCTTTGTGCTTTGTTACGCATGGAGATTGA
AA sequence
>Lus10019190 pacid=23141820 polypeptide=Lus10019190 locus=Lus10019190.g ID=Lus10019190.BGIv1.0 annot-version=v1.0
MDHHSCATMEDPPQPATPSFPGFQSSMHRDEMEYERVLTRLQRRAPTQLLIDNKHIFPTVDSASATYPSPQTCPARFGSSSGSGSFNKGGGKQDPIPLLT
PLVSPTAAGLGQQMQKQGISSLCFVTHGD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019190 0 1
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10022292 2.2 0.9514
AT3G11480 BSMT1, ATBSMT1 S-adenosyl-L-methionine-depend... Lus10036550 5.2 0.9254
AT3G50150 Plant protein of unknown funct... Lus10004516 7.1 0.9279
AT5G07990 CYP75B1, D501, ... TRANSPARENT TESTA 7, CYTOCHROM... Lus10021620 7.1 0.9025
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10040932 7.7 0.9153
AT3G50210 2-oxoglutarate (2OG) and Fe(II... Lus10006259 11.7 0.9343
AT4G18360 Aldolase-type TIM barrel famil... Lus10038507 16.5 0.9255
AT2G17080 Arabidopsis protein of unknown... Lus10025124 17.7 0.9303
Lus10026417 18.1 0.9030
AT3G46540 ENTH/VHS family protein (.1) Lus10040297 18.3 0.9324

Lus10019190 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.