Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69040 173 / 2e-53 ACR4 ACT domain repeat 4 (.1.2) AT2G03730 165 / 2e-50 ACR5 ACT domain repeat 5 (.1.2) AT3G01990 146 / 3e-43 ACR6 ACT domain repeat 6 (.1) AT1G76990 138 / 5e-40 ACR3 ACT domain repeat 3 (.1.2.3.4.5) AT1G12420 123 / 2e-34 ACR8 ACT domain repeat 8 (.1) AT5G65890 122 / 8e-34 ACR1 ACT domain repeat 1 (.1.2) AT4G22780 116 / 6e-32 ACR7 ACT domain repeat 7 (.1) AT5G25320 111 / 6e-30 ACT-like superfamily protein (.1) AT1G16880 42 / 2e-05 ACR11 ACT domain repeats 11, uridylyltransferase-related (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036827 [exp] 190 / 5e-60 AT1G69040 702 / 0.0 ACT domain repeat 4 (.1.2) Lus10041543 [exp] 154 / 3e-46 AT3G01990 605 / 0.0 ACT domain repeat 6 (.1) Lus10012550 [exp] 153 / 8e-46 AT3G01990 612 / 0.0 ACT domain repeat 6 (.1) Lus10028646 [exp] 141 / 5e-41 AT1G76990 699 / 0.0 ACT domain repeat 3 (.1.2.3.4.5) Lus10018943 [exp] 140 / 5e-40 AT1G76990 686 / 0.0 ACT domain repeat 3 (.1.2.3.4.5) Lus10003136 [exp] 133 / 4e-38 AT1G69040 520 / 0.0 ACT domain repeat 4 (.1.2) Lus10006662 [exp] 128 / 1e-36 AT4G22780 483 / 4e-170 ACT domain repeat 7 (.1) Lus10007004 [exp] 129 / 2e-36 AT1G12420 288 / 2e-92 ACT domain repeat 8 (.1) Lus10011329 [exp] 128 / 2e-36 AT1G69040 515 / 0.0 ACT domain repeat 4 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G138600 [exp] 193 / 2e-61 AT1G69040 743 / 0.0 ACT domain repeat 4 (.1.2) Potri.008G109200 [exp] 189 / 4e-59 AT1G69040 723 / 0.0 ACT domain repeat 4 (.1.2) Potri.T124144 [exp] 184 / 1e-57 AT1G69040 721 / 0.0 ACT domain repeat 4 (.1.2) Potri.001G327000 [exp] 152 / 2e-45 AT3G01990 630 / 0.0 ACT domain repeat 6 (.1) Potri.002G074800 [exp] 135 / 7e-39 AT1G76990 676 / 0.0 ACT domain repeat 3 (.1.2.3.4.5) Potri.005G185600 [exp] 134 / 9e-39 AT1G76990 709 / 0.0 ACT domain repeat 3 (.1.2.3.4.5) Potri.007G006500 [exp] 134 / 1e-38 AT5G65890 567 / 0.0 ACT domain repeat 1 (.1.2) Potri.003G116600 [exp] 132 / 8e-38 AT1G12420 624 / 0.0 ACT domain repeat 8 (.1) Potri.012G083000 [exp] 130 / 4e-37 AT1G69040 493 / 3e-173 ACT domain repeat 4 (.1.2) Potri.003G167800 [exp] 129 / 1e-36 AT1G69040 486 / 1e-170 ACT domain repeat 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0070 [flax] [poplar] ACT PF01842 [flax] [poplar] ACT ACT domain
Representative CDS sequence Show only first row Show all	>Lus10019192 pacid=23141766 polypeptide=Lus10019192 locus=Lus10019192.g ID=Lus10019192.BGIv1.0 annot-version=v1.0 ATGGAGGTCAACACGAGCTTCTCAAATGCCATGGATGATGAGTACGAGAAGCTCTTCAGAAGACTAAACCCTCCTAGGGTTGAGATTGACAATGAGGTGT GCAAGAATGCAACTGTGATTCAAGTTGATAGTGCAAACAAGCATGGGATCCTTCTGGATGTTGTCCAGATACTTACTGATCTCAATCTTATCATCACCAA AGCTTACATCTCCTCTGATGGAGGCTGGTTCATGGATGTTTTCAATGTGACAGATCAGGATGGGAACAAGATTACTGATGAAGCAATTCTTGATTACATC AGAAAGGTCAGTCACAAGCTTTTGTTTCTTCATGGTGTGTACTTTATCTGA
AA sequence Show only first row Show all	>Lus10019192 pacid=23141766 polypeptide=Lus10019192 locus=Lus10019192.g ID=Lus10019192.BGIv1.0 annot-version=v1.0 MEVNTSFSNAMDDEYEKLFRRLNPPRVEIDNEVCKNATVIQVDSANKHGILLDVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQDGNKITDEAILDYI RKVSHKLLFLHGVYFI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G69040		ACR4	ACT domain repeat 4 (.1.2)		Lus10019192 [exp]	0	1
AT1G69040		ACR4	ACT domain repeat 4 (.1.2)		Lus10036827 [exp]	2.4	0.7872
AT1G30820			CTP synthase family protein (....		Lus10001218 [exp]	2.8	0.8406
AT1G69040		ACR4	ACT domain repeat 4 (.1.2)		Lus10019191 [exp]	3.5	0.7877
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10008939 [exp]	4.9	0.7446
AT5G35740			Carbohydrate-binding X8 domain...		Lus10001740 [exp]	7.1	0.7164
AT5G08350			GRAM domain-containing protein...		Lus10013445 [exp]	9.2	0.7863
AT3G55060			unknown protein		Lus10001974 [exp]	12.1	0.7094
AT4G19210		ABCE2, ATRLI2	ARABIDOPSIS THALIANA RNASE L I...		Lus10034771 [exp]	12.7	0.7789
AT1G71440		TFCE, PFI	TUBULIN-FOLDING COFACTOR E, tu...		Lus10002949 [exp]	16.0	0.7276
AT4G31020			alpha/beta-Hydrolases superfam...		Lus10019604 [exp]	17.0	0.7159

Compare expression of checked genes

Lus10019192 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.