Lus10019198 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13635 300 / 4e-103 DNA glycosylase superfamily protein (.1.2)
AT5G57970 208 / 1e-66 DNA glycosylase superfamily protein (.1.2)
AT5G44680 202 / 2e-64 DNA glycosylase superfamily protein (.1)
AT1G75090 200 / 8e-64 DNA glycosylase superfamily protein (.1)
AT1G15970 199 / 3e-63 DNA glycosylase superfamily protein (.1)
AT1G80850 193 / 5e-61 DNA glycosylase superfamily protein (.1)
AT3G12710 186 / 3e-58 DNA glycosylase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019199 277 / 8e-95 AT1G13635 222 / 2e-71 DNA glycosylase superfamily protein (.1.2)
Lus10036835 276 / 4e-94 AT1G13635 216 / 2e-69 DNA glycosylase superfamily protein (.1.2)
Lus10026083 193 / 7e-61 AT5G57970 308 / 6e-104 DNA glycosylase superfamily protein (.1.2)
Lus10002310 189 / 3e-59 AT1G80850 299 / 3e-100 DNA glycosylase superfamily protein (.1)
Lus10036248 169 / 1e-51 AT5G44680 383 / 4e-133 DNA glycosylase superfamily protein (.1)
Lus10038388 96 / 1e-23 AT5G57970 256 / 6e-84 DNA glycosylase superfamily protein (.1.2)
Lus10028119 42 / 0.0002 AT1G30130 368 / 2e-121 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G137300 342 / 1e-119 AT1G13635 380 / 7e-133 DNA glycosylase superfamily protein (.1.2)
Potri.008G112300 320 / 5e-111 AT1G13635 372 / 9e-130 DNA glycosylase superfamily protein (.1.2)
Potri.006G184700 214 / 1e-68 AT5G57970 473 / 8e-168 DNA glycosylase superfamily protein (.1.2)
Potri.018G106900 213 / 4e-68 AT5G57970 418 / 2e-146 DNA glycosylase superfamily protein (.1.2)
Potri.003G182300 202 / 3e-64 AT5G57970 286 / 1e-94 DNA glycosylase superfamily protein (.1.2)
Potri.003G156500 202 / 1e-63 AT5G44680 370 / 8e-127 DNA glycosylase superfamily protein (.1)
Potri.014G041700 197 / 1e-62 AT1G75090 332 / 2e-113 DNA glycosylase superfamily protein (.1)
Potri.008G081000 197 / 1e-61 AT5G44680 390 / 6e-135 DNA glycosylase superfamily protein (.1)
Potri.010G175300 197 / 2e-61 AT3G12710 372 / 1e-128 DNA glycosylase superfamily protein (.1)
Potri.001G074700 192 / 1e-59 AT5G44680 395 / 7e-137 DNA glycosylase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03352 Adenine_glyco Methyladenine glycosylase
Representative CDS sequence
>Lus10019198 pacid=23141777 polypeptide=Lus10019198 locus=Lus10019198.g ID=Lus10019198.BGIv1.0 annot-version=v1.0
ATGGGAGTGATGGCAACGTTTTATCCTCACTTTCAAAATCTCAATGTTATCTCAAATAAAGGTTATGTTGCATTTCATGACGAGTGTTGGGGTGTTCCAG
TTTACGAAGACAACCAATTATTTGAGCTGCTAGCCCTATGTGGCATGTTGATGGACTACAATTGGACTGAAATTCTCAAGAGGAAAGAGCTCATCAGGAA
ATCATTTGCTGGATTTGATCCAAACATAGTGGCCAAAATGGATGAAAATGAAATCATGGACATTGTCTCCGATAAGGCCATATCCTTAGCTGAATGCCGA
GTTCGATGCATAGTCGACAATGCCAAATGCATCCTCAAGATAGTTAGAGAATTTGGATCGTTCAGTAGCTACATGTGGGGCCACATGAACCACAAGCCAA
CGATCAACAAGTTCAGGTACCCTAGAAACGTGCCGTTGAGATCACCAAAGGCGGAGGCGATGAGCAGGGAGTTATTGAGACGTGGGTTTAGATTCGTCGG
ACCTGTGATCGTGTACTCATTTATGCAAGCGGCCGGCTTGACTATAGACCACCTCGTCGACTGCTTTAGGTATAAGGAATGTGTCGCGCTTGCTGAGCGA
CCCTGGAGGCACATGTAA
AA sequence
>Lus10019198 pacid=23141777 polypeptide=Lus10019198 locus=Lus10019198.g ID=Lus10019198.BGIv1.0 annot-version=v1.0
MGVMATFYPHFQNLNVISNKGYVAFHDECWGVPVYEDNQLFELLALCGMLMDYNWTEILKRKELIRKSFAGFDPNIVAKMDENEIMDIVSDKAISLAECR
VRCIVDNAKCILKIVREFGSFSSYMWGHMNHKPTINKFRYPRNVPLRSPKAEAMSRELLRRGFRFVGPVIVYSFMQAAGLTIDHLVDCFRYKECVALAER
PWRHM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G13635 DNA glycosylase superfamily pr... Lus10019198 0 1
AT1G13635 DNA glycosylase superfamily pr... Lus10036835 1.0 0.9929
AT1G13635 DNA glycosylase superfamily pr... Lus10019199 1.4 0.9832
AT1G27920 MAP65-8 microtubule-associated protein... Lus10015789 2.8 0.9814
AT4G28500 NAC ANAC073, SND2, ... SECONDARY WALL-ASSOCIATED NAC ... Lus10018637 3.0 0.9826
AT4G14760 kinase interacting (KIP1-like)... Lus10021908 4.0 0.9730
AT5G55970 RING/U-box superfamily protein... Lus10016652 4.5 0.9806
AT1G30900 VSR6, VSR3;3, B... VACUOLAR SORTING RECEPTOR 3;3,... Lus10006944 4.9 0.9761
AT5G43230 unknown protein Lus10015804 5.0 0.9564
AT5G42710 unknown protein Lus10010807 7.1 0.9618
AT1G03010 Phototropic-responsive NPH3 fa... Lus10005943 8.7 0.9606

Lus10019198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.