Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03490 78 / 2e-18 UDP-Glycosyltransferase superfamily protein (.1) AT1G73880 71 / 9e-16 UGT89B1 UDP-glucosyl transferase 89B1 (.1) AT1G51210 69 / 4e-15 UDP-Glycosyltransferase superfamily protein (.1) AT1G06000 60 / 6e-12 UDP-Glycosyltransferase superfamily protein (.1) AT4G34138 41 / 3e-05 UGT73B1 UDP-glucosyl transferase 73B1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036837 [exp] 157 / 2e-47 AT5G03490 468 / 2e-162 UDP-Glycosyltransferase superfamily protein (.1) Lus10036840 [exp] 157 / 2e-47 AT5G03490 468 / 2e-162 UDP-Glycosyltransferase superfamily protein (.1) Lus10034650 [exp] 68 / 1e-14 AT1G73880 484 / 6e-169 UDP-glucosyl transferase 89B1 (.1) Lus10021719 [exp] 55 / 3e-11 AT1G73880 53 / 7e-10 UDP-glucosyl transferase 89B1 (.1) Lus10007972 [exp] 56 / 2e-10 AT1G73880 355 / 1e-119 UDP-glucosyl transferase 89B1 (.1) Lus10013500 [exp] 53 / 2e-09 AT1G73880 379 / 2e-127 UDP-glucosyl transferase 89B1 (.1) Lus10014079 [exp] 39 / 0.0001 AT4G34131 483 / 3e-168 UDP-glucosyl transferase 73B3 (.1) Lus10016268 [exp] 38 / 0.0004 AT2G36780 498 / 1e-173 UDP-Glycosyltransferase superfamily protein (.1) Lus10031248 [exp] 38 / 0.0004 AT5G12890 512 / 2e-179 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G137000 [exp] 79 / 1e-18 AT5G03490 482 / 4e-168 UDP-Glycosyltransferase superfamily protein (.1) Potri.012G065100 [exp] 50 / 3e-08 AT1G73880 539 / 0.0 UDP-glucosyl transferase 89B1 (.1) Potri.009G099032 [exp] 37 / 0.0006 AT2G15490 558 / 0.0 UDP-glycosyltransferase 73B4 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019201 pacid=23141827 polypeptide=Lus10019201 locus=Lus10019201.g ID=Lus10019201.BGIv1.0 annot-version=v1.0 ATGGAGGCTGACCAGTTTGTCAATGCTAGGCTGGTGGTGGAGGCCTTGGGTGTAGCCGTGAGGGTCTGCGAGGGCGGTGACACGGTACCTGATCCGGTCG AGTTGGGTAACCAGATAGCAGCGTCAATGAGTTACGGTTTGGGTGAGAGGAAAGGAGCAGACGAGCTGAAGAAGGCATTGACTGCTGTTGAAGAAGGCGG GAGCTCTCGGATTGACTTGGATAGGCTTGTTCATCAGTTACATAAACTGCACAGTCAAAGCCAAAAAGATAAAATACATTATGGTTGA
AA sequence Show only first row Show all	>Lus10019201 pacid=23141827 polypeptide=Lus10019201 locus=Lus10019201.g ID=Lus10019201.BGIv1.0 annot-version=v1.0 MEADQFVNARLVVEALGVAVRVCEGGDTVPDPVELGNQIAASMSYGLGERKGADELKKALTAVEEGGSSRIDLDRLVHQLHKLHSQSQKDKIHYG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03490			UDP-Glycosyltransferase superf...		Lus10019201 [exp]	0	1
AT5G55850		NOI	RPM1-interacting protein 4 (RI...		Lus10006250 [exp]	10.3	0.8869
AT3G60510			ATP-dependent caseinolytic (Cl...		Lus10028182 [exp]	16.3	0.8844
AT1G30500	CCAAT	NF-YA7	"nuclear factor Y, subunit A7"...		Lus10012202 [exp]	45.8	0.8646
AT4G14385			unknown protein		Lus10003559 [exp]	47.5	0.8618
					Lus10005473 [exp]	48.0	0.8170
AT3G22430			unknown protein		Lus10041203 [exp]	53.0	0.8422
AT5G47090			unknown protein		Lus10035047 [exp]	63.3	0.8568
AT1G16810			unknown protein		Lus10034837 [exp]	70.2	0.8521
AT1G60200			splicing factor PWI domain-con...		Lus10030866 [exp]	74.3	0.8196
AT3G49200			O-acyltransferase (WSD1-like) ...		Lus10019840 [exp]	77.9	0.8476

Compare expression of checked genes

Lus10019201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.