Lus10019202 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13620 43 / 7e-06 RGF2 root meristem growth factor 2, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036841 167 / 8e-54 ND 42 / 2e-05
Lus10036838 167 / 8e-54 ND 42 / 2e-05
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G112400 39 / 0.0003 AT2G04025 42 / 1e-05 root meristem growth factor 3, unknown protein
PFAM info
Representative CDS sequence
>Lus10019202 pacid=23141835 polypeptide=Lus10019202 locus=Lus10019202.g ID=Lus10019202.BGIv1.0 annot-version=v1.0
ATGAAGATTTCGTCTTCATCGTCGTCTTTTACGGCTTTACTGATCGTTGTTTTCGTCACCATTGCCACGGTTACTCTGTTGTCTCGTGCCCCGACTTCCA
ATCTTACTGCCGTTGTTGTTGCTAACGAGATTGTGCCTTCTATTCCCATCGAGGGACCATCAATGAATGTCATTATTGTCAAAGAGTCGAACATCGAACC
TGCGACAAAAACTGTCAAAAGGAGTGATAAGTATCGAAGGAGCAACGGAAAGGGAGATGATCAGAAGAGGGATGGGGAGGCTAAGCATGTTGTAGGAGGA
AGGAAATCGATGAAATTCCGTTCTGCTGTTGTTGCTGATGAAACTTCTACTGCTTCGTCGTCGTTTAAGACGTCGAAGCATAACTATGGCAATGATGCTA
GGGATCTTGTTGCTTTCACTTCTGATTATCGTTCTCCTAGACATCACCCTCCTAAGAACAACTAA
AA sequence
>Lus10019202 pacid=23141835 polypeptide=Lus10019202 locus=Lus10019202.g ID=Lus10019202.BGIv1.0 annot-version=v1.0
MKISSSSSSFTALLIVVFVTIATVTLLSRAPTSNLTAVVVANEIVPSIPIEGPSMNVIIVKESNIEPATKTVKRSDKYRRSNGKGDDQKRDGEAKHVVGG
RKSMKFRSAVVADETSTASSSFKTSKHNYGNDARDLVAFTSDYRSPRHHPPKNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G13620 RGF2 root meristem growth factor 2,... Lus10019202 0 1
Lus10022643 4.9 0.8585
AT5G23660 MTN3, SWEET12, ... homolog of Medicago truncatula... Lus10009782 7.1 0.8606
AT3G05390 unknown protein Lus10004494 7.1 0.8764
AT5G14920 Gibberellin-regulated family p... Lus10014519 10.5 0.8391
AT4G13620 AP2_ERF Integrase-type DNA-binding sup... Lus10016669 15.3 0.8403
AT1G07290 GONST2 golgi nucleotide sugar transpo... Lus10005865 18.3 0.8417
AT3G07880 SCN1 SUPERCENTIPEDE1, Immunoglobuli... Lus10001732 22.8 0.8423
AT1G44760 Adenine nucleotide alpha hydro... Lus10025644 26.5 0.8333
AT1G47980 unknown protein Lus10037797 27.6 0.8296
AT4G23430 AtTic32-IVa translocon at the inner envelo... Lus10032282 28.3 0.8578

Lus10019202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.