Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019218 pacid=23141325 polypeptide=Lus10019218 locus=Lus10019218.g ID=Lus10019218.BGIv1.0 annot-version=v1.0 ATGCAGAAGTTGGTCTTGGTACGGAGTCCGTTCGGTGTCCCTCACGCGCACGGAGGACGCACGGCCGTGCGTGTTCCGTGCGTCTCCGGTGTCACTTTTC AAAGTTTATGCTTCATTATCTGGGGAAAAGGCTGGGTTTTTATTAGATTCTCAGTTGCTTAA
AA sequence Show only first row Show all	>Lus10019218 pacid=23141325 polypeptide=Lus10019218 locus=Lus10019218.g ID=Lus10019218.BGIv1.0 annot-version=v1.0 MQKLVLVRSPFGVPHAHGGRTAVRVPCVSGVTFQSLCFIIWGKGWVFIRFSVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019218 [exp]	0	1
AT5G52170	HD	HDG7	homeodomain GLABROUS 7 (.1)		Lus10035095 [exp]	3.6	0.9444
AT1G71530			Protein kinase superfamily pro...		Lus10001470 [exp]	5.5	0.9406
AT1G65590		HEXO3, ATHEX1	beta-hexosaminidase 3 (.1)		Lus10022251 [exp]	6.3	0.9200
					Lus10030536 [exp]	6.3	0.8138
					Lus10033901 [exp]	6.5	0.9355
					Lus10014195 [exp]	11.2	0.9170
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10009583 [exp]	11.7	0.9156
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10009003 [exp]	12.0	0.9106
AT4G31920	GARP	ARR10	response regulator 10 (.1)		Lus10025044 [exp]	12.1	0.9145
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031007 [exp]	13.0	0.9108

Compare expression of checked genes

Lus10019218 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.