Lus10019222 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004294 259 / 4e-83 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G133300 155 / 1e-44 ND /
PFAM info
Representative CDS sequence
>Lus10019222 pacid=23141410 polypeptide=Lus10019222 locus=Lus10019222.g ID=Lus10019222.BGIv1.0 annot-version=v1.0
ATGCAACTGCGGTGGCTGGATGACCAACTTGATGGAAAACTTGGTTCCAATGCTGAGTGCTCACTGAATGGATGCAGAAAGTTCTTGCTCAGTGAAGGCG
ACATATTGTGTATTCCAAGAGGCTATCCACATGAGGCTTGTACTGGCGATGCTATTGCTGATGTTGTTACCAAATTCTCGTTACATCTCACATTTGGTAT
TGAGGTGGAACCTCCTTTCGAGTGGGAAGGATTTATGCATGTTTCATTTCGTGTTTGGTTTCTGAGATGGAAGGAGCACCATGGGGGTCTTTTTGAACCA
TTGACTTTTAATCTAGGTGAAATGCCCATGACTTTATTTCATGCACTGATTAGTGTCCTTGGTGTTTCTGATCCAACTTGTCGTAAGGCTTGCTTGGTTG
GTGCCCTTACTTCTCCATGTGATGCCAATGATTGGCTCTATTGA
AA sequence
>Lus10019222 pacid=23141410 polypeptide=Lus10019222 locus=Lus10019222.g ID=Lus10019222.BGIv1.0 annot-version=v1.0
MQLRWLDDQLDGKLGSNAECSLNGCRKFLLSEGDILCIPRGYPHEACTGDAIADVVTKFSLHLTFGIEVEPPFEWEGFMHVSFRVWFLRWKEHHGGLFEP
LTFNLGEMPMTLFHALISVLGVSDPTCRKACLVGALTSPCDANDWLY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019222 0 1
AT5G58510 unknown protein Lus10031851 21.5 0.6857
Lus10029801 21.8 0.6921
AT5G23490 unknown protein Lus10019229 29.3 0.6894
Lus10001749 60.8 0.6109
Lus10031222 78.0 0.6231
AT2G14255 Ankyrin repeat family protein ... Lus10000132 84.6 0.6238

Lus10019222 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.