Lus10019223 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004293 181 / 6e-60 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G071700 39 / 0.0003 ND /
PFAM info
Representative CDS sequence
>Lus10019223 pacid=23141337 polypeptide=Lus10019223 locus=Lus10019223.g ID=Lus10019223.BGIv1.0 annot-version=v1.0
ATGGATCATGTTTATTGGTCCAGCAGATTTCTCTCTTTCAAGTCTCACAACAGAATCAACGCCTGGTTCTTTCTTCTCACAAGAACAGATCATCATCTTA
GCACAATGAAATCATTGTATTTCATTATTTTCTGTTTCCTGGCAACTGCTATCTGTTTCTTTTATAATGATTTCAGTTCTTCTTCCTCTATTCTTATTCC
CCTATCAAGTAGGAGATCTATGAGGGAATGGAACGTACCGATATCTACTGCAAGCCTCGATGGACACGGCGAGGGCAAGGTTCTTGACGAAGAAAAGCGA
AAGAATTGGAAGGAAGGAGCAGACCAAGTTCAGAATGTGAAAAGTGAGGATCAAGAGGATGAGCTTATTTACCACATTGATTACAATGGTGTGATGACTC
ATCCAACTCCAACTCCAAAGGATAGACCATAG
AA sequence
>Lus10019223 pacid=23141337 polypeptide=Lus10019223 locus=Lus10019223.g ID=Lus10019223.BGIv1.0 annot-version=v1.0
MDHVYWSSRFLSFKSHNRINAWFFLLTRTDHHLSTMKSLYFIIFCFLATAICFFYNDFSSSSSILIPLSSRRSMREWNVPISTASLDGHGEGKVLDEEKR
KNWKEGADQVQNVKSEDQEDELIYHIDYNGVMTHPTPTPKDRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019223 0 1
AT4G16515 RGF6 root meristem growth factor 6,... Lus10008506 1.4 0.9944
AT3G09790 UBQ8 ubiquitin 8 (.1) Lus10022258 2.8 0.9898
Lus10025807 3.0 0.9909
Lus10004293 11.5 0.9788
AT4G34770 SAUR-like auxin-responsive pro... Lus10012185 13.5 0.9923
AT5G07010 ATST2A ARABIDOPSIS THALIANA SULFOTRAN... Lus10008673 22.2 0.9646
AT5G64330 JK218, RPT3, NP... ROOT PHOTOTROPISM 3, NON-PHOTO... Lus10040484 22.2 0.9646
AT2G20760 Clathrin light chain protein (... Lus10018582 23.6 0.9765
AT5G15350 AtENODL17 early nodulin-like protein 17 ... Lus10026064 24.1 0.9736
AT1G50310 ATSTP9 sugar transporter 9 (.1) Lus10013441 25.8 0.9885

Lus10019223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.