Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02130 62 / 6e-14 PDF2.3, LCR68 low-molecular-weight cysteine-rich 68 (.1) AT1G61070 60 / 3e-13 LCR66, PDF2.4 PLANT DEFENSIN 2.4, low-molecular-weight cysteine-rich 66 (.1) AT5G63660 59 / 4e-13 LCR74, PDF2.5 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) AT2G02120 56 / 1e-11 PDF2.1, LCR70 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) AT2G02100 56 / 2e-11 LCR69, PDF2.2 low-molecular-weight cysteine-rich 69 (.1) AT2G31957 50 / 3e-09 LCR75, LCR79 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 79, low-molecular-weight cysteine-rich 75 (.1) AT2G02147 42 / 3e-06 LCR73 low-molecular-weight cysteine-rich 73 (.1) AT2G31953 42 / 6e-06 LCR76 low-molecular-weight cysteine-rich 76 (.1) AT2G02140 41 / 6e-06 LCR72, PDF2.6 low-molecular-weight cysteine-rich 72 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004289 [exp] 127 / 1e-39 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1) Lus10004290 [exp] 94 / 2e-26 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1) Lus10019226 [exp] 92 / 2e-25 AT2G02120 81 / 6e-22 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10029544 [exp] 68 / 4e-16 AT2G02130 87 / 4e-24 low-molecular-weight cysteine-rich 68 (.1) Lus10039622 [exp] 49 / 3e-09 AT2G02120 65 / 5e-16 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10000290 [exp] 49 / 1e-08 AT2G02120 67 / 2e-16 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10029546 [exp] 48 / 2e-08 AT2G02120 65 / 1e-15 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T011301 [exp] 70 / 5e-17 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) Potri.T011300 [exp] 70 / 5e-17 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) Potri.T011201 [exp] 67 / 7e-16 AT2G02130 76 / 6e-20 low-molecular-weight cysteine-rich 68 (.1) Potri.T011200 [exp] 67 / 7e-16 AT2G02130 76 / 6e-20 low-molecular-weight cysteine-rich 68 (.1) Potri.004G138100 [exp] 63 / 2e-14 AT5G63660 71 / 4e-18 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF00304 [flax] [poplar] Gamma-thionin Gamma-thionin family
Representative CDS sequence Show only first row Show all	>Lus10019227 pacid=23141396 polypeptide=Lus10019227 locus=Lus10019227.g ID=Lus10019227.BGIv1.0 annot-version=v1.0 ATGGCGATGAAGAGCTTTTCATCTGTGGCTGCCATCCTTGTTGTGCTGCTTATCCTTGCCCCTTCCAGGGATAGCGAGGCCGGAGTGATGGTGGCAGAGG GCAGAGTGTGCCAGTCGAAGAGCCAAGGGTTCAAAGGTCCCTGCATGAGAAACCACAACTGCGCTCAGGTTTGCCGGCTTGAACACTTCACCGGCGGCGA CTGCAAAGGCTTCCGCCGCCGCGCCGTCCGCCCCACGCGGCGACTGCAAAGGCTTCCGCCGCCGTTGCTTCTGCACCAGGAAGTGCTAAATCCGGCTCAA CAAACACCACCTCTGTGTCCTCTTTGA
AA sequence Show only first row Show all	>Lus10019227 pacid=23141396 polypeptide=Lus10019227 locus=Lus10019227.g ID=Lus10019227.BGIv1.0 annot-version=v1.0 MAMKSFSSVAAILVVLLILAPSRDSEAGVMVAEGRVCQSKSQGFKGPCMRNHNCAQVCRLEHFTGGDCKGFRRRAVRPTRRLQRLPPPLLLHQEVLNPAQ QTPPLCPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02130		PDF2.3, LCR68	low-molecular-weight cysteine-...		Lus10019227 [exp]	0	1
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10017291 [exp]	2.0	0.8546
					Lus10040690 [exp]	2.2	0.8946
AT5G01600		ATFER1	ARABIDOPSIS THALIANA FERRETIN ...		Lus10022673 [exp]	4.9	0.8582
AT2G33810	SBP	SPL3	squamosa promoter binding prot...		Lus10015421 [exp]	5.1	0.8770
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10012655 [exp]	11.2	0.8338
AT4G21500			unknown protein		Lus10011256 [exp]	11.2	0.8328
AT5G64667		IDL2	inflorescence deficient in abs...		Lus10005811 [exp]	12.0	0.8169
AT5G25820			Exostosin family protein (.1)		Lus10023927 [exp]	13.1	0.8161
					Lus10018215 [exp]	14.1	0.8339
AT5G04000			unknown protein		Lus10018038 [exp]	14.7	0.8058

Compare expression of checked genes

Lus10019227 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.