Lus10019228 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04290 228 / 1e-77 Thioesterase superfamily protein (.1)
AT2G29590 95 / 3e-25 Thioesterase superfamily protein (.1)
AT3G61200 67 / 2e-14 Thioesterase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004288 313 / 2e-111 AT1G04290 226 / 5e-77 Thioesterase superfamily protein (.1)
Lus10018205 97 / 8e-26 AT2G29590 206 / 6e-69 Thioesterase superfamily protein (.1)
Lus10040701 92 / 5e-24 AT2G29590 200 / 7e-67 Thioesterase superfamily protein (.1)
Lus10018847 77 / 7e-18 AT3G61200 149 / 4e-46 Thioesterase superfamily protein (.1)
Lus10000809 74 / 4e-16 AT3G61200 135 / 3e-39 Thioesterase superfamily protein (.1)
Lus10006834 68 / 9e-15 AT3G16175 102 / 4e-28 Thioesterase superfamily protein (.1)
Lus10006837 62 / 1e-12 AT3G16175 114 / 5e-33 Thioesterase superfamily protein (.1)
Lus10037583 61 / 5e-12 AT3G16175 107 / 4e-30 Thioesterase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G134066 268 / 2e-93 AT1G04290 200 / 8e-67 Thioesterase superfamily protein (.1)
Potri.004G134132 226 / 6e-77 AT1G04290 166 / 2e-53 Thioesterase superfamily protein (.1)
Potri.009G042100 91 / 7e-24 AT2G29590 177 / 8e-58 Thioesterase superfamily protein (.1)
Potri.002G155500 72 / 3e-16 AT3G61200 139 / 4e-42 Thioesterase superfamily protein (.1)
Potri.003G051900 57 / 6e-11 AT3G16175 125 / 2e-37 Thioesterase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0050 HotDog PF03061 4HBT Thioesterase superfamily
Representative CDS sequence
>Lus10019228 pacid=23141421 polypeptide=Lus10019228 locus=Lus10019228.g ID=Lus10019228.BGIv1.0 annot-version=v1.0
ATGGATTTGGAGAGCGTAAGAAGGTATCTGGAGAAAGGAAGCGGCATCATCGAAGACGATGGAGAAGACAAGAACAGATCGGCCATCGAAGCTATTCCTT
ACAGGTTCTTCGAGCGGTTCATCATGCAAGGTCTCCAAGTCGATCTCGTCGAACCCGGCCGCGTCATTTGCTCCATGAAAGTCCCACCTCGTCTCCTGAA
CGGCGGGAACTTCTTGCACGGCGGAGCTACGGCAACTCTGGTTGATTTGGTTGGGTCAGCTGTGATTTTCACTGTTGGAGCTCCCCAGACTGGAGTCTCT
GTTGAAATCAACGTCTCATATTTGGATGCTGCTTATGTTGACGATGAGATCGAGATCGAAGCCAAGATTCTGCGAGTCGGGAAGGCAGTTGGAGTCGTGA
GCGTAGAGTTAAGGAAGAAGAAGACCGGGAAACTCATCGCGCAGGGGCGTCATACCAAGTATCTTGCTGTATCTAGCAAATTGTAA
AA sequence
>Lus10019228 pacid=23141421 polypeptide=Lus10019228 locus=Lus10019228.g ID=Lus10019228.BGIv1.0 annot-version=v1.0
MDLESVRRYLEKGSGIIEDDGEDKNRSAIEAIPYRFFERFIMQGLQVDLVEPGRVICSMKVPPRLLNGGNFLHGGATATLVDLVGSAVIFTVGAPQTGVS
VEINVSYLDAAYVDDEIEIEAKILRVGKAVGVVSVELRKKKTGKLIAQGRHTKYLAVSSKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04290 Thioesterase superfamily prote... Lus10019228 0 1
AT5G62200 Embryo-specific protein 3, (AT... Lus10027387 3.2 0.8767
AT1G25682 Family of unknown function (DU... Lus10034268 6.5 0.8660
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Lus10042328 7.3 0.8775
AT4G17070 peptidyl-prolyl cis-trans isom... Lus10036745 13.4 0.8495
AT1G28490 OSM1, ATSYP61, ... syntaxin of plants 61 (.1.2) Lus10017686 16.6 0.8756
AT5G27720 LSM4, EMB1644 SM-like protein 4, embryo defe... Lus10004221 16.9 0.8498
AT5G47890 NADH-ubiquinone oxidoreductase... Lus10030922 20.8 0.8504
AT5G04910 unknown protein Lus10008941 21.4 0.8414
AT5G27720 LSM4, EMB1644 SM-like protein 4, embryo defe... Lus10029426 21.5 0.8555
AT5G58740 HSP20-like chaperones superfam... Lus10018234 22.4 0.8688

Lus10019228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.