Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10530 44 / 2e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT5G65600 42 / 2e-05 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004279 [exp] 118 / 2e-32 AT5G10530 578 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10007079 [exp] 56 / 2e-10 AT5G10530 335 / 3e-111 Concanavalin A-like lectin protein kinase family protein (.1) Lus10020456 [exp] 54 / 1e-09 AT5G10530 519 / 1e-176 Concanavalin A-like lectin protein kinase family protein (.1) Lus10029555 [exp] 48 / 1e-07 AT5G10530 687 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10004277 [exp] 47 / 2e-07 AT5G10530 707 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10020452 [exp] 44 / 4e-06 AT5G10530 510 / 2e-173 Concanavalin A-like lectin protein kinase family protein (.1) Lus10007074 [exp] 41 / 2e-05 AT5G10530 426 / 4e-143 Concanavalin A-like lectin protein kinase family protein (.1) Lus10020446 [exp] 41 / 2e-05 AT5G10530 516 / 2e-175 Concanavalin A-like lectin protein kinase family protein (.1) Lus10016833 [exp] 41 / 2e-05 AT5G10530 575 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G004200 [exp] 71 / 9e-16 AT5G10530 570 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283700 [exp] 58 / 2e-11 AT5G10530 497 / 7e-168 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283866 [exp] 58 / 2e-11 AT5G10530 478 / 3e-160 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283208 [exp] 58 / 2e-11 AT5G10530 478 / 3e-160 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283400 [exp] 55 / 3e-10 AT5G10530 494 / 6e-167 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283204 [exp] 55 / 3e-10 AT5G10530 472 / 3e-159 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283212 [exp] 54 / 6e-10 AT5G10530 385 / 3e-124 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283500 [exp] 52 / 7e-10 AT5G10530 90 / 8e-22 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283200 [exp] 54 / 8e-10 AT5G10530 382 / 8e-125 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G262866 [exp] 54 / 8e-10 AT5G10530 384 / 1e-124 Concanavalin A-like lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019233 pacid=23141403 polypeptide=Lus10019233 locus=Lus10019233.g ID=Lus10019233.BGIv1.0 annot-version=v1.0 ATGAATCGGCCGTCGATTAGGCAGGTGATTAGCGTGCTGAAGATGGAGGCGCCGTTGCCGAGTCTGCCGGCGAAGTTGCCCGTGCCGAGGTATTACGCGC CGCCGCTGGATATCACGAAGGTTAAGTCGTATGATACGACGTCGTCTGGTAACGTGGGGGCGGGGAAAACGGGGGTTTCGCAAACGAGTTATGCTACGAC GACGTCGATGAGTTCTTCGACGAGGTCGGCGTGGTCTCAGGATGGGTTGTTGGTTTCTCAGAAGAGTTAA
AA sequence Show only first row Show all	>Lus10019233 pacid=23141403 polypeptide=Lus10019233 locus=Lus10019233.g ID=Lus10019233.BGIv1.0 annot-version=v1.0 MNRPSIRQVISVLKMEAPLPSLPAKLPVPRYYAPPLDITKVKSYDTTSSGNVGAGKTGVSQTSYATTTSMSSSTRSAWSQDGLLVSQKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10530			Concanavalin A-like lectin pro...		Lus10019233 [exp]	0	1
AT3G47570			Leucine-rich repeat protein ki...		Lus10035726 [exp]	184.0	0.6859

Compare expression of checked genes

Lus10019233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.