Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21192 140 / 1e-45 Cytochrome c oxidase biogenesis protein Cmc1-like (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011579 [exp] 138 / 2e-39 AT3G49650 950 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G227500 [exp] 146 / 8e-48 AT4G21192 137 / 3e-44 Cytochrome c oxidase biogenesis protein Cmc1-like (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF08583 [flax] [poplar] Cmc1 Cytochrome c oxidase biogenesis protein Cmc1 like
Representative CDS sequence Show only first row Show all	>Lus10019246 pacid=23141294 polypeptide=Lus10019246 locus=Lus10019246.g ID=Lus10019246.BGIv1.0 annot-version=v1.0 ATGCATCCTCCGTTGACGTTACACAGGCACCCTATGTGTGCTGAAATTATAGAGGAGTTCCAGAAGTGTCACATGGACCATCCTTTAGGAAAGTTCTTTG GTGAGTGTACAGAACTCAAGATCAAGCTAGACCGTTGTTTCCGCCAGGAGAAATCTGTGAAGAGGAAGGCGAATTTCGAAGAGAGCAAGAAACTGAAAGA AAGGCTGCAAGCTATGCGGAAAGAAGCTGCTGCTGCTGAAAGGAGCATGCAAGCTTAA
AA sequence Show only first row Show all	>Lus10019246 pacid=23141294 polypeptide=Lus10019246 locus=Lus10019246.g ID=Lus10019246.BGIv1.0 annot-version=v1.0 MHPPLTLHRHPMCAEIIEEFQKCHMDHPLGKFFGECTELKIKLDRCFRQEKSVKRKANFEESKKLKERLQAMRKEAAAAERSMQA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21192			Cytochrome c oxidase biogenesi...		Lus10019246 [exp]	0	1
AT1G55340			Protein of unknown function (D...		Lus10010312 [exp]	1.0	0.8930
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008023 [exp]	1.4	0.8885
AT5G51960			unknown protein		Lus10036504 [exp]	2.8	0.8636
AT5G55140			ribosomal protein L30 family p...		Lus10031912 [exp]	4.2	0.8725
AT3G11591			unknown protein		Lus10016986 [exp]	4.2	0.8589
AT2G28470		BGAL8	beta-galactosidase 8 (.1.2)		Lus10011237 [exp]	6.1	0.8140
AT3G61113			Ubiquitin related modifier 1 (...		Lus10036551 [exp]	9.5	0.8608
					Lus10006003 [exp]	9.5	0.8542
AT1G60560			SWIM zinc finger family protei...		Lus10035898 [exp]	10.7	0.8289
AT1G22140			unknown protein		Lus10025627 [exp]	13.1	0.8484

Compare expression of checked genes

Lus10019246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.