Lus10019250 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37830 69 / 7e-16 cytochrome c oxidase-related (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011574 126 / 1e-38 AT4G37830 135 / 1e-42 cytochrome c oxidase-related (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G008800 83 / 3e-21 AT4G37830 89 / 4e-24 cytochrome c oxidase-related (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02046 COX6A Cytochrome c oxidase subunit VIa
Representative CDS sequence
>Lus10019250 pacid=23141355 polypeptide=Lus10019250 locus=Lus10019250.g ID=Lus10019250.BGIv1.0 annot-version=v1.0
ATGGCGTCGGCGGCGATTCTGCGATCTGGTGTTCTTCGAAGCGCTCTTCGCGGCGGCTCAAAGGCCTCCGCTCCGGCCAAGCGCCAATTCTCTGCTTCCG
CTCATCAGGACGTTGAATTCGAGGCGAAGGAAGCAGCGAAATGGGAGAAGATCACATACCTCGGAGCTGCTACTTGTACGGCTCTAGCTACCTACTGCTT
GTCGAAGGGACACCCTCACTCAGAGGAGCCACCGGCATATCCCTATCTTCATATCCGCAACAAGGAGTTCCCATGGGGTAATCTTTCTCTGGCGAGAACT
TATGTTTTGAAAAACTTATGCTTTATTATTCGAGACTGTTATAAGAACTACAATGCCTTCCTAGAATCGCCAAAGATTTGTCTCCCCTCGGTGAAATTGC
GTACCTTTAGATAA
AA sequence
>Lus10019250 pacid=23141355 polypeptide=Lus10019250 locus=Lus10019250.g ID=Lus10019250.BGIv1.0 annot-version=v1.0
MASAAILRSGVLRSALRGGSKASAPAKRQFSASAHQDVEFEAKEAAKWEKITYLGAATCTALATYCLSKGHPHSEEPPAYPYLHIRNKEFPWGNLSLART
YVLKNLCFIIRDCYKNYNAFLESPKICLPSVKLRTFR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G37830 cytochrome c oxidase-related (... Lus10019250 0 1
AT5G13450 ATP5 delta subunit of Mt ATP syntha... Lus10019706 1.4 0.9523
AT5G40650 SDH2-2 succinate dehydrogenase 2-2 (.... Lus10032113 1.4 0.9595
AT4G00860 AT0ZI1, ATOZI1 Arabidopsis thaliana ozone-ind... Lus10007542 4.2 0.9450
AT5G41670 6-phosphogluconate dehydrogena... Lus10024725 4.2 0.9509
AT2G20420 ATP citrate lyase (ACL) family... Lus10008238 4.5 0.9499
AT3G44150 unknown protein Lus10029366 5.3 0.9429
AT4G10040 CYTC-2 cytochrome c-2 (.1) Lus10028892 6.0 0.9413
AT1G30890 Integral membrane HRF1 family ... Lus10025577 6.6 0.9387
AT2G42210 ATOEP16-3 Mitochondrial import inner mem... Lus10012024 7.5 0.9369
AT3G47810 ATVPS29, MAG1 VACUOLAR PROTEIN SORTING 29, M... Lus10030497 7.7 0.9283

Lus10019250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.