Lus10019270 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37710 45 / 1e-06 VQ motif-containing protein (.1)
AT2G22880 40 / 0.0001 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011555 186 / 6e-61 AT4G37710 47 / 2e-07 VQ motif-containing protein (.1)
Lus10039654 50 / 2e-07 ND 41 / 1e-04
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G006200 57 / 2e-10 AT4G37710 / VQ motif-containing protein (.1)
Potri.014G006400 52 / 1e-08 AT4G37710 / VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Lus10019270 pacid=23141378 polypeptide=Lus10019270 locus=Lus10019270.g ID=Lus10019270.BGIv1.0 annot-version=v1.0
ATGGAAGCTTATCAATCTACAACCATCATTATGGAAGCCAACTCATCATCGTCATCCGCCACGTCATCGATGAACCGGCCGAGCAAGAGGAAGCTACACA
CTGCCCCCTTGCCACCTAACCCTCCCAGGGTCTACCAGGTCGACCCGGTCAACTTCCGGGACCTGGTCCAGCGTCTCACCGGTTCGACCTCCGAAGCATC
AATGCAGCCTCCTCAACGGCGGAGGATGCAGAGCTTGGCTCCTCCGCCGCTCGAGGAGCAGCAACACCTTCCGACGACGAGGATGAGAAGGAGTAGTAAT
AGTAATGATGCTCCGTCGCCGTTGACGGCAATGTGTAGGGAGCTGATGATGGATGATGAAACTGCGGGGATCGAAATGCGGCCTTCTTCTTCTTCGTCAT
CGTTGGAGCTGAATCTTTCCTCGTCGGCGGTGGTTGCTAATTCTTCGTCGCAATACTGGTATCCTCAGATGTTGAGTAATGGTGGGAGCTTGTGA
AA sequence
>Lus10019270 pacid=23141378 polypeptide=Lus10019270 locus=Lus10019270.g ID=Lus10019270.BGIv1.0 annot-version=v1.0
MEAYQSTTIIMEANSSSSSATSSMNRPSKRKLHTAPLPPNPPRVYQVDPVNFRDLVQRLTGSTSEASMQPPQRRRMQSLAPPPLEEQQHLPTTRMRRSSN
SNDAPSPLTAMCRELMMDDETAGIEMRPSSSSSSLELNLSSSAVVANSSSQYWYPQMLSNGGSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G37710 VQ motif-containing protein (.... Lus10019270 0 1
Lus10008536 1.0 0.8395
AT1G01720 NAC ATAF1, ANAC002 Arabidopsis NAC domain contain... Lus10042731 4.5 0.7892
AT1G01490 Heavy metal transport/detoxifi... Lus10027524 4.7 0.7969
AT4G10955 alpha/beta-Hydrolases superfam... Lus10023072 13.1 0.7452
Lus10036058 13.9 0.7459
AT4G31540 ATEXO70G1 exocyst subunit exo70 family p... Lus10014917 15.3 0.7453
AT5G04010 F-box family protein (.1) Lus10031031 15.9 0.7558
AT1G80450 VQ motif-containing protein (.... Lus10020092 15.9 0.6867
AT1G24420 HXXXD-type acyl-transferase fa... Lus10036077 16.1 0.7445
AT2G27690 CYP94C1 "cytochrome P450, family 94, s... Lus10043378 17.2 0.7920

Lus10019270 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.