Lus10019272 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011721 40 / 5e-05 AT3G49780 53 / 3e-10 phytosulfokine 4 precursor (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10019272 pacid=23141363 polypeptide=Lus10019272 locus=Lus10019272.g ID=Lus10019272.BGIv1.0 annot-version=v1.0
ATGGCTTCAAATGTTAAGGTGATTACCACCTTCCTCCTCCTCCTCCTCTTCAGCCTCTTCGCCTCCGCAGTCCGGCCCGATCTTGCCGGAGTAGTTCCGC
TAGCTCCGGTAGTAGCTCCCACCGACTTGCCTCTTTCCTTTGTCGGTTCCGACGGCCACAATTTCGACCCTATGGTCGACCGGGGCGATCCCGAATCCTT
TGCCGTCAGCAGCTCCCACAAGTCCGTGGAAGGGCACGACATGGTTGAGCAGGATCTCTGCGAAGGGCTGGGAGAAGAGGACTGCTTGACGAAAAAGCCA
TGGAAATTTTGA
AA sequence
>Lus10019272 pacid=23141363 polypeptide=Lus10019272 locus=Lus10019272.g ID=Lus10019272.BGIv1.0 annot-version=v1.0
MASNVKVITTFLLLLLFSLFASAVRPDLAGVVPLAPVVAPTDLPLSFVGSDGHNFDPMVDRGDPESFAVSSSHKSVEGHDMVEQDLCEGLGEEDCLTKKP
WKF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019272 0 1
AT1G55910 ZIP11 zinc transporter 11 precursor ... Lus10004413 1.4 0.8923
AT1G47750 PEX11A peroxin 11A (.1) Lus10029260 2.6 0.8998
Lus10023370 5.2 0.8913
AT5G13810 Glutaredoxin family protein (.... Lus10039537 9.0 0.8706
AT3G16210 F-box family protein (.1) Lus10023372 9.8 0.8723
AT1G27730 C2H2ZnF ZAT10, STZ salt tolerance zinc finger (.1... Lus10033798 14.1 0.8533
AT3G57450 unknown protein Lus10042063 19.1 0.8479
AT3G07870 F-box and associated interacti... Lus10038606 19.8 0.8730
AT1G33800 Protein of unknown function (D... Lus10034373 21.4 0.8776
Lus10029977 26.2 0.8750

Lus10019272 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.