Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49910 153 / 5e-49 Translation protein SH3-like family protein (.1) AT5G67510 141 / 2e-44 Translation protein SH3-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028537 [exp] 168 / 6e-55 AT3G49910 262 / 1e-91 Translation protein SH3-like family protein (.1) Lus10018139 [exp] 168 / 6e-55 AT3G49910 262 / 1e-91 Translation protein SH3-like family protein (.1) Lus10011540 [exp] 130 / 1e-40 AT3G49910 178 / 3e-59 Translation protein SH3-like family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G085200 [exp] 156 / 2e-50 AT3G49910 241 / 3e-83 Translation protein SH3-like family protein (.1) Potri.007G055900 [exp] 152 / 6e-49 AT3G49910 236 / 2e-81 Translation protein SH3-like family protein (.1) Potri.005G082600 [exp] 151 / 2e-48 AT3G49910 214 / 2e-72 Translation protein SH3-like family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0107 [flax] [poplar] KOW PF00467 [flax] [poplar] KOW KOW motif
Representative CDS sequence Show only first row Show all	>Lus10019283 pacid=23141323 polypeptide=Lus10019283 locus=Lus10019283.g ID=Lus10019283.BGIv1.0 annot-version=v1.0 ATGAGCGCCCCCCTCTCGACCGACCTCCGCCAGAAGTACAACGTCCGCTCCATGCCAGTCCGCAAGGACGACGAGGTCCAGGTCGTCAGGGGAACATTCA AGGGCCGCGAGGGCAAAGTCGTGCAGGTCTACCGCCGGAAGTGGGTGATCCACATCGAGCGCATCACCAGGGAGAAGGTGAACGGATCCACCGTCAACGT CGGCATCCACCCTTCCAAGGTCGTCGTCACCAAGCTCCGCCTCGACAAGGACCGCAAGTCGCTGCTCGACCGCAAGGCTAAAGGACGCGCTGCTGCTGAT AAGGAGAAGGGCACCGCTGATGATATTATGCAGAACGTCGATTGA
AA sequence Show only first row Show all	>Lus10019283 pacid=23141323 polypeptide=Lus10019283 locus=Lus10019283.g ID=Lus10019283.BGIv1.0 annot-version=v1.0 MSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTFKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGIHPSKVVVTKLRLDKDRKSLLDRKAKGRAAAD KEKGTADDIMQNVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G49910			Translation protein SH3-like f...		Lus10019283 [exp]	0	1
AT1G33140		PGY2	PIGGYBACK2, Ribosomal protein ...		Lus10032962 [exp]	1.0	0.9566
AT5G44500			Small nuclear ribonucleoprotei...		Lus10023386 [exp]	2.4	0.9478
AT3G09630			Ribosomal protein L4/L1 family...		Lus10019904 [exp]	3.0	0.9525
AT5G07900			Mitochondrial transcription te...		Lus10041122 [exp]	3.0	0.9410
AT3G11400		ATEIF3G1, EIF3G...	eukaryotic translation initiat...		Lus10030482 [exp]	4.0	0.9495
AT3G49910			Translation protein SH3-like f...		Lus10018139 [exp]	5.5	0.9564
AT4G36130			Ribosomal protein L2 family (....		Lus10025966 [exp]	6.3	0.9096
AT5G60670			Ribosomal protein L11 family p...		Lus10041308 [exp]	7.0	0.9416
AT4G35490		MRPL11	mitochondrial ribosomal protei...		Lus10035432 [exp]	8.2	0.9274
AT1G02140		MAGO, HAP1, MEE...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10029791 [exp]	9.6	0.9038

Compare expression of checked genes

Lus10019283 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.