Plant FIBer expression Database

Lus10019293 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37560 92 / 2e-23 Acetamidase/Formamidase family protein (.1)
AT4G37550 74 / 4e-17 Acetamidase/Formamidase family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011529
[exp]
148 / 4e-47 AT4G37560 93 / 2e-22 Acetamidase/Formamidase family protein (.1)
Lus10019294
[exp]
109 / 4e-33 AT4G37560 77 / 3e-18 Acetamidase/Formamidase family protein (.1)
Lus10011528
[exp]
84 / 3e-20 AT4G37560 797 / 0.0 Acetamidase/Formamidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G145400
[exp]
93 / 9e-24 AT4G37560 797 / 0.0 Acetamidase/Formamidase family protein (.1)
Potri.007G053750
[exp]
0 / 1 AT4G37560 0 / 1 Acetamidase/Formamidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03069 FmdA_AmdA Acetamidase/Formamidase family
Representative CDS sequence
>Lus10019293 pacid=23141432 polypeptide=Lus10019293 locus=Lus10019293.g ID=Lus10019293.BGIv1.0 annot-version=v1.0
ATGGCTCAAAGGAAGCAATACGGTGCAAGAGTTGTGTTCCCCATAGACCTGAAGAAGGAGCCATGTCAGCAGGAGCTTCCCCTCCACAACAGGTGGCACC
CGGACATCCCTCCGGTGGCCGAAGTCGTAACCGGAGAGCTTTTCCGGGTGGAGATGTTTGATGCCACCGGCGGCCGCATCACTCCGGAGTTCACCGCCGA
GGACGTCAAGTCCGCCGACCTTTCTGTCTCGCGAGCAAGTCTCGAAGTAGGAGTGGACATTCGGTCATAA
AA sequence
>Lus10019293 pacid=23141432 polypeptide=Lus10019293 locus=Lus10019293.g ID=Lus10019293.BGIv1.0 annot-version=v1.0
MAQRKQYGARVVFPIDLKKEPCQQELPLHNRWHPDIPPVAEVVTGELFRVEMFDATGGRITPEFTAEDVKSADLSVSRASLEVGVDIRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G37560 Acetamidase/Formamidase family... Lus10019293
[exp]
0 1
AT5G66040 STR16 sulfurtransferase protein 16 (... Lus10005635
[exp]
1.4 0.8891
AT4G33590 unknown protein Lus10036463
[exp]
9.2 0.8151
AT2G37530 unknown protein Lus10024416
[exp]
18.5 0.8786
AT1G79700 AP2_ERF Integrase-type DNA-binding sup... Lus10005513
[exp]
21.6 0.8443
AT3G11780 MD-2-related lipid recognition... Lus10021256
[exp]
41.4 0.8418
AT3G12720 MYB ATMYB67, AtY53 myb domain protein 67 (.1) Lus10001226
[exp]
44.0 0.7729
Lus10008896
[exp]
51.3 0.8243
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10006542
[exp]
54.0 0.8096
AT1G64000 WRKY ATWRKY56, WRKY5... WRKY DNA-binding protein 56 (.... Lus10007906
[exp]
58.4 0.8346
AT5G66040 STR16 sulfurtransferase protein 16 (... Lus10021227
[exp]
61.2 0.8342

Lus10019293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.