Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37560 54 / 3e-10 Acetamidase/Formamidase family protein (.1) AT4G37550 44 / 9e-07 Acetamidase/Formamidase family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019293 [exp] 86 / 1e-23 AT4G37560 92 / 3e-23 Acetamidase/Formamidase family protein (.1) Lus10011529 [exp] 84 / 4e-22 AT4G37560 93 / 2e-22 Acetamidase/Formamidase family protein (.1) Lus10011528 [exp] 55 / 2e-10 AT4G37560 797 / 0.0 Acetamidase/Formamidase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G145400 [exp] 59 / 7e-12 AT4G37560 797 / 0.0 Acetamidase/Formamidase family protein (.1) Potri.007G053750 [exp] 39 / 2e-05 AT4G37560 0 / 1 Acetamidase/Formamidase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03069 [flax] [poplar] FmdA_AmdA Acetamidase/Formamidase family
Representative CDS sequence Show only first row Show all	>Lus10019294 pacid=23141340 polypeptide=Lus10019294 locus=Lus10019294.g ID=Lus10019294.BGIv1.0 annot-version=v1.0 ATGGCTCAAAGAAGGCAATACGGTGCAAGAGTTGTGTTTCCCACAGACTTGAAGAAGAAGCCATGGCAGCAGGAGCTTCCCCTTCGCAACAGGTGGCACC CGGACATCCCTCCAGTGGCCGAAGTAGTCGCCGAGGAGGTTTTCCGGGTGGAGATGATGGATTTCAGCGGCGGACGCATCACTCGCGAGTTGATATCAAG TTCGCCGATCCTACTGTCATGA
AA sequence Show only first row Show all	>Lus10019294 pacid=23141340 polypeptide=Lus10019294 locus=Lus10019294.g ID=Lus10019294.BGIv1.0 annot-version=v1.0 MAQRRQYGARVVFPTDLKKKPWQQELPLRNRWHPDIPPVAEVVAEEVFRVEMMDFSGGRITRELISSSPILLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37560			Acetamidase/Formamidase family...		Lus10019294 [exp]	0	1
AT4G31115			Protein of unknown function (D...		Lus10025683 [exp]	73.0	0.6370
AT5G55840			Pentatricopeptide repeat (PPR)...		Lus10038697 [exp]	105.8	0.6448
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10026237 [exp]	123.0	0.6524
					Lus10039737 [exp]	152.5	0.6358
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036078 [exp]	168.9	0.6184
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Lus10030317 [exp]	275.4	0.6157

Compare expression of checked genes

Lus10019294 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.