Lus10019304 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs

No hit found

Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10019304 pacid=23141328 polypeptide=Lus10019304 locus=Lus10019304.g ID=Lus10019304.BGIv1.0 annot-version=v1.0
ATGGAGCGCAAGAGTATGCTTCTTCTCGCATTGGTGGCCGTAATCGTCGCCGGAGTTGGCGGCCAAGCTCCCGCCGCCACTCCTACCTCCACTCCCACCG
TCCCCGCCGCTGCACCATCCACCAACTCTTCATCCTCAGCTCCCACCGCATCTCCACCAACAGCCGCTGCCCCGACCTCCACTCCACCAGCAGCTGCACC
CGTCGCCACTCCACCGGCAGCCACCGTCGCTCCAGTAAGCTCCCCCCCTACAGCTGCTGCTCCAGTCAGCTCCCCACCAACAGCAACACCTGCCCCCCCT
CCACCCGCCCCCCACCCCGCCCCCAGCTCCCGTCGCCGCTACTCCTCCCGCAGCATCTCCTCCCGCCGCTGA
AA sequence
>Lus10019304 pacid=23141328 polypeptide=Lus10019304 locus=Lus10019304.g ID=Lus10019304.BGIv1.0 annot-version=v1.0
MERKSMLLLALVAVIVAGVGGQAPAATPTSTPTVPAAAPSTNSSSSAPTASPPTAAAPTSTPPAAAPVATPPAATVAPVSSPPTAAAPVSSPPTATPAPP
PPAPHPAPSSRRRYSSRSISSRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019304 0 1
AT1G08200 AXS2 UDP-D-apiose/UDP-D-xylose synt... Lus10005370 3.9 0.9214
AT2G29390 ATSMO2-2, SMO2-... Arabidopsis thaliana sterol 4-... Lus10040739 4.2 0.9111
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10004348 4.5 0.9310
AT3G28180 ATCSLC4, CSLC4,... CELLULOSE-SYNTHASE LIKE C4, Ce... Lus10039440 5.1 0.9307
AT4G24330 Protein of unknown function (D... Lus10019958 5.6 0.8708
AT1G20330 FRL1, CVP1, SMT... FRILL1, COTYLEDON VASCULAR PAT... Lus10023995 6.2 0.8995
AT3G63470 SCPL40 serine carboxypeptidase-like 4... Lus10005327 6.9 0.9273
AT1G21000 PLATZ transcription factor fam... Lus10027735 7.4 0.9073
AT3G54770 RNA-binding (RRM/RBD/RNP motif... Lus10023485 8.1 0.9177
AT5G41330 BTB/POZ domain with WD40/YVTN ... Lus10028780 11.0 0.9153

Lus10019304 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.