Lus10019306 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G23140 175 / 2e-50 RING/U-box superfamily protein with ARM repeat domain (.1.2)
AT5G67340 149 / 1e-41 ARM repeat superfamily protein (.1)
AT3G54790 99 / 7e-24 ARM repeat superfamily protein (.1.2)
AT1G23030 77 / 3e-16 PUB11 ARM repeat superfamily protein (.1)
AT3G46510 77 / 4e-16 ATPUB13 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1)
AT1G71020 76 / 6e-16 ARM repeat superfamily protein (.1.2)
AT5G42340 75 / 2e-15 PUB15 Plant U-Box 15 (.1)
AT2G28830 73 / 9e-15 AtPUB12 PLANT U-BOX 12 (.1)
AT3G54850 72 / 2e-14 ATPUB14 plant U-box 14 (.1)
AT1G24330 72 / 2e-14 ARM repeat superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011514 239 / 8e-73 AT2G23140 916 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Lus10019308 234 / 4e-71 AT2G23140 911 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Lus10011516 184 / 3e-54 AT2G23140 410 / 5e-134 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Lus10022919 107 / 1e-26 AT2G23140 549 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Lus10024899 107 / 2e-26 AT2G23140 551 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Lus10043471 83 / 5e-18 AT1G71020 682 / 0.0 ARM repeat superfamily protein (.1.2)
Lus10034113 82 / 7e-18 AT3G59770 1913 / 0.0 ARABIDOPSIS THALIANA SUPPRESSOR OF ACTIN 9, sacI homology domain-containing protein / WW domain-containing protein (.1.2.3)
Lus10037970 77 / 4e-16 AT3G54850 803 / 0.0 plant U-box 14 (.1)
Lus10038699 77 / 4e-16 AT3G54850 599 / 0.0 plant U-box 14 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G051000 207 / 3e-62 AT2G23140 1018 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Potri.005G144700 201 / 1e-59 AT2G23140 972 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Potri.005G225400 113 / 8e-29 AT3G54790 736 / 0.0 ARM repeat superfamily protein (.1.2)
Potri.002G037700 107 / 1e-26 AT3G54790 707 / 0.0 ARM repeat superfamily protein (.1.2)
Potri.002G009900 82 / 6e-18 AT5G42340 763 / 0.0 Plant U-Box 15 (.1)
Potri.010G113900 79 / 9e-17 AT1G23030 732 / 0.0 ARM repeat superfamily protein (.1)
Potri.010G226500 78 / 2e-16 AT3G54850 806 / 0.0 plant U-box 14 (.1)
Potri.008G035700 77 / 3e-16 AT3G54850 821 / 0.0 plant U-box 14 (.1)
Potri.008G128600 76 / 7e-16 AT1G23030 697 / 0.0 ARM repeat superfamily protein (.1)
Potri.009G165900 75 / 1e-15 AT5G42340 671 / 0.0 Plant U-Box 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF04564 U-box U-box domain
Representative CDS sequence
>Lus10019306 pacid=23141423 polypeptide=Lus10019306 locus=Lus10019306.g ID=Lus10019306.BGIv1.0 annot-version=v1.0
ATGTGGGGTCTGAGTACAAGTGGAGTTATAAGTTACAACACACACGGACCCCGCTTCCGCCTTTATAAGATTCGAAACTTGGGTCTGGATATTGCTGAGC
TCTTGAAGTCTGACAATGAACATCTACCTGAACAATCGAGTTCATCATCGTCATCTACGGAGTACTGCATACAGAAGCTTGAGAACTTGGGACTGGAAGA
AACGTCATTGACTGTTGAGGCGGCCATAAAGGATCGAGTGGAAGGTATTGGAACCGACGCTGATATCCTAGCTGAAATTGCTGTCAGTTTGAGCTTGAGA
ACCAATCTGGAGATTCTGATAGAACCAGTGGCACTCGAGAATTTGAAGGAAGCTGCTGACCAAGCTGAAAGAAGTGAGGAAGTTGAGTTATTTGATCAAC
TGATTGGTCTGGTCACCAGGATGCATGATCAGCTGATTATTCGAGTGCAAAAATTCAAAACAAGTAGCCTTGCTCCGATACCACCACCTGATTTCTGCTG
TCCTCTATCGCTTGAGTTGATGAAAGATCCAGTAAATGTGGCATCTGGACAGACCTATGAACGGTCATTTATCAAAAGCTGGATCGAACTTGGCCTAACA
GTATGTCCCAAGACACGGCATGTCCTTGGACACTTTTATGATCACGAATTATACTGTCAAGGCCTTGATTGCTAA
AA sequence
>Lus10019306 pacid=23141423 polypeptide=Lus10019306 locus=Lus10019306.g ID=Lus10019306.BGIv1.0 annot-version=v1.0
MWGLSTSGVISYNTHGPRFRLYKIRNLGLDIAELLKSDNEHLPEQSSSSSSSTEYCIQKLENLGLEETSLTVEAAIKDRVEGIGTDADILAEIAVSLSLR
TNLEILIEPVALENLKEAADQAERSEEVELFDQLIGLVTRMHDQLIIRVQKFKTSSLAPIPPPDFCCPLSLELMKDPVNVASGQTYERSFIKSWIELGLT
VCPKTRHVLGHFYDHELYCQGLDC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G23140 RING/U-box superfamily protein... Lus10019306 0 1
AT4G37440 unknown protein Lus10019305 2.6 0.7256
AT2G24520 AHA5 H\(+\)-ATPase 5, H\(+\)-ATPase... Lus10020148 6.9 0.7122
AT5G36930 Disease resistance protein (TI... Lus10008415 11.5 0.6062
AT2G24520 AHA5 H\(+\)-ATPase 5, H\(+\)-ATPase... Lus10020147 15.3 0.6485
AT3G55960 Haloacid dehalogenase-like hyd... Lus10040202 18.1 0.6744
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10000203 19.9 0.6916
Lus10015577 22.2 0.6331
Lus10042413 22.4 0.6306
Lus10022574 24.3 0.6630
Lus10013650 42.3 0.6286

Lus10019306 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.