Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37290 53 / 2e-10 unknown protein AT2G23270 50 / 2e-09 unknown protein AT1G49800 45 / 3e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011512 [exp] 145 / 1e-46 AT4G37290 57 / 3e-12 unknown protein Lus10010255 [exp] 97 / 1e-27 AT4G37290 54 / 6e-11 unknown protein Lus10010257 [exp] 58 / 3e-12 ND 37 / 3e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G049500 [exp] 76 / 3e-19 AT4G37290 48 / 1e-08 unknown protein Potri.016G015600 [exp] 70 / 6e-17 AT4G37290 45 / 2e-07 unknown protein Potri.005G142900 [exp] 69 / 8e-17 AT4G37290 44 / 4e-07 unknown protein Potri.006G008066 [exp] 69 / 1e-15 AT2G23270 45 / 2e-06 unknown protein Potri.007G049400 [exp] 55 / 2e-11 AT4G37290 46 / 5e-08 unknown protein Potri.001G299800 [exp] 49 / 8e-09 AT1G49800 44 / 1e-06 unknown protein Potri.006G008132 [exp] 50 / 1e-08 ND / Potri.009G095600 [exp] 45 / 3e-07 AT1G49800 / unknown protein Potri.001G299900 [exp] 42 / 3e-06 AT1G49800 48 / 2e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019310 pacid=23141375 polypeptide=Lus10019310 locus=Lus10019310.g ID=Lus10019310.BGIv1.0 annot-version=v1.0 ATGGCAGGCGGGTTCAGATCGGTTCGGTTAGCGATCATCGCTCTGTTGGTGGTCTCTGTCCTTCTACTAACTTCCGGAGCGCAAGCGGGTCGGCCGTTGA ACATATTGAACACGGAGGCAGCAGTCTCGATGGACCGATTCTTCGACGGGTTGGCTCTGGGTGCGATCAAGGAATCGGGACCGAGTCCAGGAGTGGGTCA CTCGTTCACCAACAGCCTCAACTCGTTGGGAGGAAGAAAGAACTCCGGGCCGAGTCCCGGAGTGGGTCACCAGTTTGTTACTGGTACCCGCCAATGA
AA sequence Show only first row Show all	>Lus10019310 pacid=23141375 polypeptide=Lus10019310 locus=Lus10019310.g ID=Lus10019310.BGIv1.0 annot-version=v1.0 MAGGFRSVRLAIIALLVVSVLLLTSGAQAGRPLNILNTEAAVSMDRFFDGLALGAIKESGPSPGVGHSFTNSLNSLGGRKNSGPSPGVGHQFVTGTRQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37290			unknown protein		Lus10019310 [exp]	0	1
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10022762 [exp]	1.4	0.9974
AT5G37490			ARM repeat superfamily protein...		Lus10001079 [exp]	1.4	0.9980
AT4G37290			unknown protein		Lus10010255 [exp]	3.0	0.9969
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10028377 [exp]	4.0	0.9961
AT3G26770			NAD(P)-binding Rossmann-fold s...		Lus10021313 [exp]	4.5	0.9931
AT1G14550			Peroxidase superfamily protein...		Lus10009902 [exp]	4.9	0.9940
AT1G14590			Nucleotide-diphospho-sugar tra...		Lus10041973 [exp]	5.9	0.9956
AT1G35210			unknown protein		Lus10010343 [exp]	7.9	0.9932
AT1G10370		GST30B, ATGSTU1...	GLUTATHIONE S-TRANSFERASE U17,...		Lus10030806 [exp]	8.4	0.9933
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10021314 [exp]	8.8	0.9931

Compare expression of checked genes

Lus10019310 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.