Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37280 85 / 2e-21 MRG family protein (.1) AT1G02740 66 / 2e-14 MRG family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011511 [exp] 93 / 2e-24 AT4G37280 449 / 5e-160 MRG family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G049300 [exp] 86 / 5e-22 AT4G37280 417 / 2e-147 MRG family protein (.1) Potri.014G022400 [exp] 50 / 8e-09 AT1G02740 314 / 2e-106 MRG family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0049 [flax] [poplar] Tudor PF11717 [flax] [poplar] Tudor-knot RNA binding activity-knot of a chromodomain
Representative CDS sequence Show only first row Show all	>Lus10019311 pacid=23141310 polypeptide=Lus10019311 locus=Lus10019311.g ID=Lus10019311.BGIv1.0 annot-version=v1.0 ATGGGCAACTCATCCAAGAACGATTCCGGCAGCGACGGCGACGCCTCCAGCGGCGATACTCCGCCTCCTGACTCCAACCATTTCACCGAAGGCGAGCGCG TCCTCGCCTACCACGGTCCTCGAATCTACGAAGCCAAGGTTCAAAAAGCCGAGCTACGGAAGAAGGAATGGAAATACTTCGTTCACTATCTTGGATGGAA TAAGAAGTGA
AA sequence Show only first row Show all	>Lus10019311 pacid=23141310 polypeptide=Lus10019311 locus=Lus10019311.g ID=Lus10019311.BGIv1.0 annot-version=v1.0 MGNSSKNDSGSDGDASSGDTPPPDSNHFTEGERVLAYHGPRIYEAKVQKAELRKKEWKYFVHYLGWNKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37280			MRG family protein (.1)		Lus10019311 [exp]	0	1
AT1G60080			3'-5'-exoribonuclease family p...		Lus10034605 [exp]	18.2	0.7005
AT1G69400			Transducin/WD40 repeat-like su...		Lus10026051 [exp]	24.1	0.7081
AT1G04010		ATPSAT1	phospholipid sterol acyl trans...		Lus10003615 [exp]	25.8	0.6996
					Lus10007709 [exp]	33.7	0.5937
AT5G05920		DHS, EDA22	embryo sac development arrest ...		Lus10042728 [exp]	37.9	0.6744
AT5G42240		SCPL42	serine carboxypeptidase-like 4...		Lus10018924 [exp]	38.8	0.6789
AT1G79350		EMB1135	embryo defective 1135, RING/FY...		Lus10001760 [exp]	52.4	0.6698
AT2G02955		MEE12	maternal effect embryo arrest ...		Lus10004454 [exp]	68.1	0.6605
AT3G54860		ATVPS33	VACUOLAR PROTEIN SORTING 33, S...		Lus10037969 [exp]	71.0	0.6447
AT4G25540		ATMSH3, MSH3	homolog of DNA mismatch repair...		Lus10027452 [exp]	71.3	0.6260

Compare expression of checked genes

Lus10019311 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.