Lus10019330 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009375 44 / 3e-06 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10019330 pacid=23141346 polypeptide=Lus10019330 locus=Lus10019330.g ID=Lus10019330.BGIv1.0 annot-version=v1.0
ATGAATGATGTGGTTGCTGAGATAGAGAAGGTTTGTCCAAAGCAGCAACCTATGGATAGCTCTTCTCCACAACAAGGTGTCTGGCCACTCCGTGTCGAGT
GGGAACAGAGGACGGCGGAGAGGGAGCAGGAGTTGGAATGGAGGGCTGCGGAGAGGGAGCGGGAGTGGAACGAGCGATGTACTCGGATGGAGGCTGAGAT
AGAGCGGTTGCAGGCGGAGTTGGCGGCAAAGGCTAAGAAAGTAAGTTACCGTTGA
AA sequence
>Lus10019330 pacid=23141346 polypeptide=Lus10019330 locus=Lus10019330.g ID=Lus10019330.BGIv1.0 annot-version=v1.0
MNDVVAEIEKVCPKQQPMDSSSPQQGVWPLRVEWEQRTAEREQELEWRAAEREREWNERCTRMEAEIERLQAELAAKAKKVSYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019330 0 1
AT2G46520 cellular apoptosis susceptibil... Lus10030433 124.4 0.6195
AT1G47840 HXK3 hexokinase 3 (.1) Lus10002041 124.6 0.6546
Lus10000079 156.7 0.6992
AT3G58110 unknown protein Lus10002186 160.0 0.6619
AT4G19550 zinc ion binding;transcription... Lus10006630 163.8 0.6655
AT1G07410 ATRAB-A2B, AtRA... ARABIDOPSIS RAB GTPASE HOMOLOG... Lus10040255 169.0 0.6483
AT4G19190 zinc knuckle (CCHC-type) famil... Lus10035690 172.5 0.6767
AT3G49601 unknown protein Lus10008501 183.9 0.6603
AT3G44150 unknown protein Lus10023845 201.3 0.6281
AT4G40045 unknown protein Lus10034155 230.8 0.6418

Lus10019330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.