Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67020 96 / 2e-25 unknown protein AT3G50340 91 / 2e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G044200 [exp] 103 / 4e-28 AT5G67020 537 / 0.0 unknown protein Potri.005G138300 [exp] 103 / 6e-28 AT5G67020 520 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019344 pacid=23141404 polypeptide=Lus10019344 locus=Lus10019344.g ID=Lus10019344.BGIv1.0 annot-version=v1.0 ATGGGTTGGTTGGATAATCAAGCTGTCCTGGACGGTTTGCTGGTTAAAGCGGGTCGATTTTCCGATTCGCTCCAAAAAGCCGGGTGGAGCTCCGAGGAAG TGGCGGATGTTCTTGGGTTTGATTTTCGAGCTGTGAAGAAAAGGAAACCGGTTGTGAAGCTGTCGCCCGTGCTCGTGGAAAAGATCGAGAAGCTGGTCGA ATCGGTTTCGAGATAG
AA sequence Show only first row Show all	>Lus10019344 pacid=23141404 polypeptide=Lus10019344 locus=Lus10019344.g ID=Lus10019344.BGIv1.0 annot-version=v1.0 MGWLDNQAVLDGLLVKAGRFSDSLQKAGWSSEEVADVLGFDFRAVKKRKPVVKLSPVLVEKIEKLVESVSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G67020			unknown protein		Lus10019344 [exp]	0	1
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10025818 [exp]	1.0	0.9599
AT4G22560			unknown protein		Lus10028927 [exp]	2.0	0.9532
AT3G63000		NPL41	NPL4-like protein 1 (.1)		Lus10021567 [exp]	2.0	0.9491
AT5G57360		LKP1, FKL2, ADO...	ZEITLUPE, LOV KELCH PROTEIN 1,...		Lus10025470 [exp]	2.2	0.9482
AT2G29380		HAI3	highly ABA-induced PP2C gene 3...		Lus10003399 [exp]	2.4	0.9516
AT5G08060			unknown protein		Lus10021149 [exp]	2.4	0.9474
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Lus10040428 [exp]	4.0	0.9455
AT2G46800		ATMTP1, ZAT1, Z...	ZINC TRANSPORTER OF ARABIDOPSI...		Lus10030192 [exp]	4.4	0.9187
AT4G29680			Alkaline-phosphatase-like fami...		Lus10032681 [exp]	4.7	0.9364
AT1G65720			unknown protein		Lus10031363 [exp]	5.2	0.9393

Compare expression of checked genes

Lus10019344 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.