Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30710 84 / 6e-20 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008148 [exp] 228 / 3e-74 AT2G30710 625 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G134200 [exp] 122 / 4e-34 AT2G30710 692 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019369 pacid=23163224 polypeptide=Lus10019369 locus=Lus10019369.g ID=Lus10019369.BGIv1.0 annot-version=v1.0 ATGTTAAAAGGGCGTAGTATTCCCGGTAAAGTCTTGCTAACCCGGAAGTCACCATCAGAGGATCCAAGTTTACAAGAACATTCTCCAACCTTTCAAAGAA GCTACTCAGAAAATGACGCTGATACAAGTAATCAGAGTGACACATCAAGAGAGGAAGATGCGTGGAGTGCAAATAAACCAAATAGTATTTCTGTTGCCAA CAAATTAAAACCCCGTACTTCCAGTGTTGAGGTTTCACATGGAGAAGGTCAGAAGTCAACTGTGGGTGCTAGAGCAACCGATAATGCCAGAGTTATGAAG TTCACTAAAGAACTATCAGGAGCTACTGTAATGTTAGGTACATTCACTATATTGATGTGA
AA sequence Show only first row Show all	>Lus10019369 pacid=23163224 polypeptide=Lus10019369 locus=Lus10019369.g ID=Lus10019369.BGIv1.0 annot-version=v1.0 MLKGRSIPGKVLLTRKSPSEDPSLQEHSPTFQRSYSENDADTSNQSDTSREEDAWSANKPNSISVANKLKPRTSSVEVSHGEGQKSTVGARATDNARVMK FTKELSGATVMLGTFTILM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30710			Ypt/Rab-GAP domain of gyp1p su...		Lus10019369 [exp]	0	1
AT2G40820			unknown protein		Lus10038998 [exp]	8.2	0.7880
AT1G35780			unknown protein		Lus10009931 [exp]	8.8	0.7819
AT4G03560		FOU2, ATCCH1, A...	FATTY ACID OXYGENATION UPREGUL...		Lus10018594 [exp]	27.6	0.7576
AT5G16730			Plant protein of unknown funct...		Lus10009550 [exp]	28.6	0.7773
AT2G47500			P-loop nucleoside triphosphate...		Lus10010301 [exp]	31.7	0.7735
AT2G38670		PECT1	phosphorylethanolamine cytidyl...		Lus10021592 [exp]	44.5	0.7450
AT3G54260		TBL36	TRICHOME BIREFRINGENCE-LIKE 36...		Lus10026066 [exp]	47.2	0.7398
AT4G30710		QWRF8	QWRF domain containing 8, Fami...		Lus10010780 [exp]	51.0	0.7444
AT1G48270		GCR1	G-protein-coupled receptor 1 (...		Lus10017120 [exp]	59.4	0.7031
AT2G16405			Transducin/WD40 repeat-like su...		Lus10017483 [exp]	61.8	0.7458

Compare expression of checked genes

Lus10019369 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.