Lus10019370 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30710 544 / 0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
AT1G04830 97 / 2e-22 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
AT4G13730 89 / 2e-19 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3)
AT3G07890 79 / 3e-16 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
AT3G02460 78 / 4e-16 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
AT5G15930 75 / 4e-15 PAM1 plant adhesion molecule 1 (.1)
AT2G43490 72 / 1e-13 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6)
AT3G59570 71 / 2e-13 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
AT2G37290 66 / 9e-12 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
AT4G28550 64 / 4e-11 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008148 602 / 0 AT2G30710 625 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Lus10027046 515 / 0 AT2G30710 526 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Lus10037829 91 / 5e-20 AT1G04830 537 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
Lus10017104 86 / 2e-18 AT1G04830 580 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
Lus10004802 79 / 6e-16 AT2G43490 499 / 2e-170 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6)
Lus10012363 74 / 1e-14 AT3G07890 698 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
Lus10006410 74 / 1e-14 AT3G07890 701 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
Lus10034099 74 / 1e-14 AT3G02460 573 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
Lus10003047 73 / 2e-14 AT3G02460 577 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G134200 564 / 0 AT2G30710 692 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Potri.018G131300 95 / 1e-21 AT4G13730 414 / 4e-142 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3)
Potri.017G057100 94 / 3e-21 AT4G13730 602 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3)
Potri.001G316700 93 / 5e-21 AT4G13730 586 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3)
Potri.006G069300 92 / 1e-20 AT4G13730 385 / 1e-130 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3)
Potri.017G023200 77 / 2e-15 AT2G43490 795 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6)
Potri.002G218100 76 / 3e-15 AT3G07890 696 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
Potri.007G132900 76 / 4e-15 AT2G43490 808 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6)
Potri.017G109000 74 / 9e-15 AT5G15930 575 / 0.0 plant adhesion molecule 1 (.1)
Potri.014G163400 74 / 9e-15 AT3G07890 719 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Representative CDS sequence
>Lus10019370 pacid=23163246 polypeptide=Lus10019370 locus=Lus10019370.g ID=Lus10019370.BGIv1.0 annot-version=v1.0
ATGATTTACTGTATAGAGAAACTTCGCGAGTTAGCTTGGAGTGGTGTACCACCTTATATGCGGCCTGATGTTTGGAGGCTTCTCTTGGGATATGCACCAT
CTAATTCAGATAGAAGGGATGTAGTACTCAGAAGAAAGCGGCTGGAGTATCTTGAATGCGTTGCTCAATTTTACGACATTCCTGATTCTGATCGTTCTGA
TGATGAACTAAACATGCTTCGTCAGATTGCTGTTGACTGTCCAAGAACTGTACCTGATGTCATATTCTTTCAGCAAACACAAGTTCAAAAATCCTTGGAG
CGCATTCTTTATACATGGGCCATTCGGCATCCGGCAAGTGGATATGTTCAGGGTATAAATGATCTTGCGACGCCATTTCTGATAGTGTTCCTATCCGAAT
ACTTGGAGGGAGATATAGATAATTGGTCTATTTGCGATCTCCCTACAGAGAAAATCTTTGACGTGGAAGCTGACTGTTACTGGTGCCTGTCAAAGTTACT
AGATGGGATGCAAGATCATTACACATTTGCGCAGCCGGGAATACAAAGGCTTGTGTTTAGGCTGAAAGAATTGGTTAGACGCATAGATGAATCTGTTTCA
GCGCACGTGGAAGAGCAAGGGCTTGAATTTCTTCAATTTGCATTTCGATGGTTCAACTGTCTGTTGATAAGGGAGATCCCTTTTAATCTTGTAACAAGGC
TGTGGGACACCTACCTAGCTGAAGGAGATGCGTTGCCTGATTTCCTAGTGTACATATTCGCCAGCTTTCTTCTGACGTGGTCAGAGAAGCTTCAGAAGCT
TGATTTCCAGGAGCTGGTAATGTTTCTGCAGCACCTACCCACACGTAACTGGGGTCACCAGGAACTAGAGATGGTGCTATCAAGAGCTTATATGTGGCAT
AGTATGTTTAACAACTCTCCTAGCCACTTGGCTAGCTAA
AA sequence
>Lus10019370 pacid=23163246 polypeptide=Lus10019370 locus=Lus10019370.g ID=Lus10019370.BGIv1.0 annot-version=v1.0
MIYCIEKLRELAWSGVPPYMRPDVWRLLLGYAPSNSDRRDVVLRRKRLEYLECVAQFYDIPDSDRSDDELNMLRQIAVDCPRTVPDVIFFQQTQVQKSLE
RILYTWAIRHPASGYVQGINDLATPFLIVFLSEYLEGDIDNWSICDLPTEKIFDVEADCYWCLSKLLDGMQDHYTFAQPGIQRLVFRLKELVRRIDESVS
AHVEEQGLEFLQFAFRWFNCLLIREIPFNLVTRLWDTYLAEGDALPDFLVYIFASFLLTWSEKLQKLDFQELVMFLQHLPTRNWGHQELEMVLSRAYMWH
SMFNNSPSHLAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G30710 Ypt/Rab-GAP domain of gyp1p su... Lus10019370 0 1
AT5G20090 Uncharacterised protein family... Lus10025851 7.1 0.8839
AT1G73177 APC13, BNS anaphase-promoting complex 13,... Lus10007286 10.5 0.8702
AT2G30710 Ypt/Rab-GAP domain of gyp1p su... Lus10008148 11.4 0.7963
AT1G24120 ARL1 ARG1-like 1 (.1) Lus10030827 12.0 0.8750
AT3G46060 ARA3, Ara-3, At... RAB GTPase homolog 8A (.1.2.3) Lus10024423 19.2 0.8513
AT1G63380 NAD(P)-binding Rossmann-fold s... Lus10006698 21.3 0.8632
Lus10003137 24.3 0.8406
AT1G55510 BCDH BETA1, BCD... branched-chain alpha-keto acid... Lus10010324 33.0 0.8459
AT5G09260 VPS20.2 vacuolar protein sorting-assoc... Lus10015693 37.3 0.8516
Lus10001241 38.3 0.8511

Lus10019370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.