Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036170 [exp] 95 / 1e-23 AT5G20930 753 / 0.0 TOUSLED, Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019384 pacid=23163234 polypeptide=Lus10019384 locus=Lus10019384.g ID=Lus10019384.BGIv1.0 annot-version=v1.0 ATGCTGAGAAGAAGAAGCAACGTGGTGCGGACGATGCTGAGCCTAGCGTCATGGAGCCAGAGTTCTGACGAGAAGCAAAGACTTAGTGAAGCTGTGGAGA ACAAACCTATGGTTGACGTACATAAGCGAAAGCAAGGTCGTGGCAGGGGAAATTCGGTCTCAGTTAGGGGTCGAGGTTCCAGAGTTACTGATCAGACAAG ATTACAGGTTTCTGCTTCAACAGTTTCCCCTCAAGTTGTTAATGGCCATCTTGAGACTTTGCACAAGGTATTCCTGTCCATAAAACTTGATGTTCTTATC TGCTTAGTGTTTGGTGCTATCGGGATCACGTTCATAGTTCTTGATATTCTTACAGAAGTAAGTCCAGCTGGATTGTCATTATTGTAG
AA sequence Show only first row Show all	>Lus10019384 pacid=23163234 polypeptide=Lus10019384 locus=Lus10019384.g ID=Lus10019384.BGIv1.0 annot-version=v1.0 MLRRRSNVVRTMLSLASWSQSSDEKQRLSEAVENKPMVDVHKRKQGRGRGNSVSVRGRGSRVTDQTRLQVSASTVSPQVVNGHLETLHKVFLSIKLDVLI CLVFGAIGITFIVLDILTEVSPAGLSLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019384 [exp]	0	1
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10028871 [exp]	4.6	0.9267
AT3G54280		RGD3, ATBTAF1, ...	ROOT GROWTH DEFECTIVE 3, DNA b...		Lus10003868 [exp]	15.4	0.9193
AT2G36850		CHOR, ATGSL8, A...	CHORUS, glucan synthase-like 8...		Lus10040892 [exp]	16.0	0.9207
AT4G03090			sequence-specific DNA binding;...		Lus10006938 [exp]	17.9	0.9170
AT3G54280		RGD3, ATBTAF1, ...	ROOT GROWTH DEFECTIVE 3, DNA b...		Lus10013625 [exp]	23.3	0.9171
AT5G10470		KAC1, KCA1	KINESIN CDKA;1 ASSOCIATED 1, k...		Lus10035941 [exp]	25.8	0.9152
AT3G43610			Spc97 / Spc98 family of spindl...		Lus10003354 [exp]	30.2	0.9041
AT1G58250		SAB	SABRE, Golgi-body localisation...		Lus10024283 [exp]	31.2	0.9099
					Lus10004082 [exp]	35.1	0.9042
AT5G27970			ARM repeat superfamily protein...		Lus10004116 [exp]	36.3	0.9077

Compare expression of checked genes

Lus10019384 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.