Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26580 223 / 1e-74 YABBY YAB5 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) AT1G08465 166 / 5e-52 YABBY YAB2 YABBY2, Plant-specific transcription factor YABBY family protein (.1) AT2G45190 152 / 2e-46 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) AT1G23420 123 / 8e-35 YABBY INO, YAB4 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) AT1G69180 107 / 3e-29 YABBY CRC CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) AT4G00180 106 / 1e-28 YABBY YAB3 YABBY3, Plant-specific transcription factor YABBY family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043264 [exp] 275 / 1e-89 AT5G35410 630 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Lus10030105 [exp] 182 / 1e-56 AT2G26580 172 / 3e-53 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Lus10032240 [exp] 159 / 1e-48 AT2G45190 193 / 1e-61 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10024603 [exp] 155 / 3e-47 AT2G45190 190 / 2e-60 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10029135 [exp] 148 / 1e-44 AT1G23420 200 / 9e-65 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10013028 [exp] 132 / 2e-38 AT1G23420 193 / 4e-62 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10036811 [exp] 112 / 2e-31 AT1G69180 187 / 4e-61 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) Lus10010361 [exp] 115 / 3e-31 AT2G45190 171 / 4e-53 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10000644 [exp] 107 / 5e-29 AT1G69180 177 / 5e-57 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G129800 [exp] 224 / 5e-75 AT2G26580 250 / 5e-86 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.006G067800 [exp] 223 / 2e-74 AT2G26580 253 / 5e-87 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.009G000100 [exp] 171 / 2e-54 AT1G08465 215 / 3e-72 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.003G112800 [exp] 171 / 7e-54 AT2G45190 243 / 1e-81 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.014G066700 [exp] 171 / 9e-54 AT2G45190 277 / 3e-95 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.001G120200 [exp] 171 / 1e-53 AT2G45190 236 / 4e-79 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.002G145100 [exp] 158 / 6e-49 AT2G45190 265 / 2e-90 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.001G214700 [exp] 147 / 1e-44 AT1G08465 183 / 8e-59 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.008G189000 [exp] 139 / 2e-41 AT1G23420 213 / 7e-70 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Potri.010G042400 [exp] 137 / 1e-40 AT1G23420 191 / 3e-61 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [flax] [poplar] HMG-box PF04690 [flax] [poplar] YABBY YABBY protein
Representative CDS sequence Show only first row Show all	>Lus10019407 pacid=23181592 polypeptide=Lus10019407 locus=Lus10019407.g ID=Lus10019407.BGIv1.0 annot-version=v1.0 ATGGGAAGCTGCATAGAGATGGTGGCTGAGCAGCTTTGTTACATCCCTTGCAACTTCTGCAATATTGTTCTTGCGGTGAGCGTTCCATGCAGCAATCTGA TGGACATAGTAACAGTGAGATGCGGTCACTGCACTAACCTGTGGTCAGTGAATATGGCTGCTGCGTTTCAGTACTCTCTTTCAGCTTCCCGTGCCCAGCA GCAGCAGCAGCAACCAGCCGATCACCTCTCCCTTCACCACCACCAGAAGGGAGGAAACTACAATGTGTATCAAGCAGGAGGGAGCACAAATAATGATCAA CAGTATTACAATGGAGGTGGAGGCTCATCATCATCATCTTCTTCTTCTGCCAAGTCCATCCCCACTGCCAAATTAACAACCCGTACTTCACCTCTCCCAC CTCTCCAAAATCGAATCGTTAATCGACCTCCCGAGAAGCGTCAGCGAGTGCCTTCTGCATACAACCAGTTCATCAAGGAAGAGATCCAGAGGATCAAAGC CAATAACCCAGACATCACTCACCGTGAAGCTTTTAGCACCGCCGCTAACAATTGGGCACACTTCCCCCATATCCATTTCGGGTTGATGTTGGAGTCCAAC AAGAAAGCTACTTACTAA
AA sequence Show only first row Show all	>Lus10019407 pacid=23181592 polypeptide=Lus10019407 locus=Lus10019407.g ID=Lus10019407.BGIv1.0 annot-version=v1.0 MGSCIEMVAEQLCYIPCNFCNIVLAVSVPCSNLMDIVTVRCGHCTNLWSVNMAAAFQYSLSASRAQQQQQQPADHLSLHHHQKGGNYNVYQAGGSTNNDQ QYYNGGGGSSSSSSSSAKSIPTAKLTTRTSPLPPLQNRIVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDITHREAFSTAANNWAHFPHIHFGLMLESN KKATY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G26580	YABBY	YAB5	YABBY5, plant-specific transcr...		Lus10019407 [exp]	0	1
AT1G15260			unknown protein		Lus10011448 [exp]	1.4	0.9658
AT1G13290	C2H2ZnF	WIP6, DOT5	WIP domain protein 6, DEFECTIV...		Lus10021700 [exp]	1.7	0.9624
AT5G60970	TCP	TCP5	TEOSINTE BRANCHED 1, cycloidea...		Lus10017856 [exp]	2.0	0.9615
AT4G37810			unknown protein		Lus10007240 [exp]	2.2	0.9577
AT4G12310		CYP706A5	"cytochrome P450, family 706, ...		Lus10032210 [exp]	3.2	0.9642
AT5G18880			RNA-directed DNA polymerase (r...		Lus10023044 [exp]	3.5	0.9502
AT1G67260	TCP	TCP1	TCP family transcription facto...		Lus10034072 [exp]	6.7	0.9452
AT3G47570			Leucine-rich repeat protein ki...		Lus10030852 [exp]	7.2	0.8950
AT2G01770		ATVIT1, VIT1	vacuolar iron transporter 1 (....		Lus10021809 [exp]	7.3	0.9327
					Lus10026122 [exp]	9.2	0.9030

Compare expression of checked genes

Lus10019407 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.