Lus10019409 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20190 156 / 2e-46 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G80130 139 / 1e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G32340 110 / 3e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G17940 100 / 4e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G04530 81 / 1e-17 TPR4 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G07280 79 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
AT2G29670 76 / 1e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043266 382 / 8e-136 AT5G20190 162 / 1e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030103 253 / 6e-84 AT5G20190 179 / 1e-54 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002166 252 / 1e-83 AT5G20190 192 / 8e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002013 124 / 9e-34 AT4G32340 152 / 5e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024949 104 / 1e-25 AT4G17940 125 / 8e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022877 100 / 1e-24 AT4G17940 121 / 5e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000257 100 / 3e-24 AT1G04530 179 / 3e-52 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014468 100 / 7e-24 AT1G04530 177 / 1e-51 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10023721 100 / 9e-24 AT1G04530 171 / 4e-49 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G130100 199 / 5e-63 AT5G20190 180 / 5e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G130300 192 / 3e-60 AT5G20190 166 / 2e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G068200 183 / 9e-57 AT5G20190 167 / 6e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G254300 122 / 7e-34 AT4G32340 157 / 2e-47 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G256900 103 / 1e-25 AT4G17940 125 / 2e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G140500 100 / 2e-25 AT4G17940 196 / 9e-62 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G065400 91 / 6e-21 AT1G04530 160 / 5e-46 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G172200 90 / 2e-20 AT1G04530 137 / 1e-36 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G191600 73 / 1e-14 AT2G29670 328 / 3e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G250100 72 / 4e-14 AT2G29670 499 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10019409 pacid=23181607 polypeptide=Lus10019409 locus=Lus10019409.g ID=Lus10019409.BGIv1.0 annot-version=v1.0
ATGCTTCTACGAAGCTCATCAACTCCGATACTGAATTCATGGATTCCACACTCCAAAGATCAACATCAGTCACCGAAATCCGATTCCTTACCCCAAATTC
CGAGGACCCCATCCGTAACCTTGACCGCCTCATCTTCCAGCCCAATCTCGTCCCCTCCATTCTCTTCCCGTGGTGATTACGTCGGCAAAATGACGAGGGC
GCTTTCCGAGACGGATCTGCGGAGTCTGTCATCATCAGCCCCGGTTCCGAAGAAGAATCCGATGGCCATCGGGTTAATGAACGGGTTAACCGTCGAGGAG
AAGGACGAGGAGGAGGAGGAAACGGCGTCTTTCGATTGCGGGTTCGTTTGGGGATCCAACGGGTTGGGCGAAAAAACCGGATCGGAATGCGGCTTGTCGA
CGCTCGTGGCCGGCGACGGAGCTGGCGGATGCGGCGGGAGGACAGGAACCGGCGGCCACGGTGGCGGGAGCGAGGAGTCTTCGGATTCGAATTATAAGAC
GGAGGTGTATTACGAGACAATGATCGAATCTAATCCTGGGAATTCGTTACTGATGGGGAACTACGCTAGGTTCTTGAAAGATGTTCGTGGGGATTTGGTG
AAGGCGGAAGAGTATTGCGGGAGAGCAATCCTGGTGAACCCTAACGACGGAGGTGTTCTTTCCATGTACGCCGATTTGATTTGGAGGAGCCACAAGGATT
CTTCGAGAGCTGAGAGCTATTATGATCGTGCTGTTAAAGCCGCCCCTGAGGATTCGTAA
AA sequence
>Lus10019409 pacid=23181607 polypeptide=Lus10019409 locus=Lus10019409.g ID=Lus10019409.BGIv1.0 annot-version=v1.0
MLLRSSSTPILNSWIPHSKDQHQSPKSDSLPQIPRTPSVTLTASSSSPISSPPFSSRGDYVGKMTRALSETDLRSLSSSAPVPKKNPMAIGLMNGLTVEE
KDEEEEETASFDCGFVWGSNGLGEKTGSECGLSTLVAGDGAGGCGGRTGTGGHGGGSEESSDSNYKTEVYYETMIESNPGNSLLMGNYARFLKDVRGDLV
KAEEYCGRAILVNPNDGGVLSMYADLIWRSHKDSSRAESYYDRAVKAAPEDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20190 Tetratricopeptide repeat (TPR)... Lus10019409 0 1
AT5G20190 Tetratricopeptide repeat (TPR)... Lus10043266 2.0 0.8675
AT2G18170 ATMPK7 MAP kinase 7 (.1) Lus10014283 3.5 0.8871
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10030261 5.3 0.8931
AT3G50120 Plant protein of unknown funct... Lus10019324 9.3 0.8329
AT5G47240 ATNUDT8 nudix hydrolase homolog 8 (.1) Lus10004371 10.4 0.8302
AT5G67080 MAPKKK19 mitogen-activated protein kina... Lus10009364 12.4 0.8421
AT1G18190 GC2 golgin candidate 2 (.1) Lus10009060 13.0 0.8558
AT1G32640 bHLH JIN1, JAI1, ZBF... JASMONATE INSENSITIVE 1, Basic... Lus10030970 17.9 0.8220
AT1G53903 Protein of unknown function (D... Lus10003939 18.1 0.8824
AT5G46590 NAC ANAC096 NAC domain containing protein ... Lus10010294 19.8 0.7848

Lus10019409 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.