Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80130 45 / 4e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G20190 40 / 7e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G32340 39 / 0.0001 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024755 [exp] 82 / 6e-21 ND / Lus10032838 [exp] 79 / 9e-20 AT1G40087 46 / 9e-06 Plant transposase (Ptta/En/Spm family) (.1) Lus10042950 [exp] 72 / 7e-18 ND / Lus10043266 [exp] 48 / 6e-08 AT5G20190 162 / 1e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019409 [exp] 48 / 8e-08 AT5G20190 164 / 1e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10002166 [exp] 45 / 9e-07 AT5G20190 192 / 8e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030103 [exp] 44 / 2e-06 AT5G20190 179 / 1e-54 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G130300 [exp] 41 / 1e-05 AT5G20190 166 / 2e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G130100 [exp] 41 / 2e-05 AT5G20190 180 / 5e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G068200 [exp] 40 / 3e-05 AT5G20190 167 / 6e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G254300 [exp] 40 / 3e-05 AT4G32340 157 / 2e-47 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019410 pacid=23181572 polypeptide=Lus10019410 locus=Lus10019410.g ID=Lus10019410.BGIv1.0 annot-version=v1.0 ATGATCGAAGCTAATCCTGGGAATTCGTTACTGCTGGGGAACTACGCACGGTTCTTGAAAGATGTAGACATGACTGATGATGAGCCATTTGCGGATGAGC ACATTGAGGGTGAGGACAACACCGATGATGAGGTCGGTCCGTCTCAAGTGACACGTGTTTCTACTAATAAAGCTGCTCCACATCACTATCGATTGGAGTT AATTGGTGAGTGTAATATATTTTTGCAAAAGTTTGAGCAATGTGGTTCTTGA
AA sequence Show only first row Show all	>Lus10019410 pacid=23181572 polypeptide=Lus10019410 locus=Lus10019410.g ID=Lus10019410.BGIv1.0 annot-version=v1.0 MIEANPGNSLLLGNYARFLKDVDMTDDEPFADEHIEGEDNTDDEVGPSQVTRVSTNKAAPHHYRLELIGECNIFLQKFEQCGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019410 [exp]	0	1
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10029872 [exp]	3.5	0.9778
AT4G28110	MYB	ATMYB41	myb domain protein 41 (.1)		Lus10033738 [exp]	4.5	0.9776
AT5G15430			Plant calmodulin-binding prote...		Lus10000141 [exp]	5.5	0.9770
AT5G37710			alpha/beta-Hydrolases superfam...		Lus10005809 [exp]	6.2	0.9529
AT1G11340			S-locus lectin protein kinase ...		Lus10036139 [exp]	6.3	0.9739
AT2G47430		CKI1	CYTOKININ-INDEPENDENT 1, Signa...		Lus10035113 [exp]	7.3	0.9156
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	7.7	0.9734
					Lus10015828 [exp]	8.8	0.9724
AT2G27410	B3		Domain of unknown function (DU...		Lus10027284 [exp]	9.4	0.9682
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	9.5	0.9705

Compare expression of checked genes

Lus10019410 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.