Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20180 114 / 2e-34 Ribosomal protein L36 (.1.2) ATCG00760 37 / 6e-05 ATCG00760.1, RPL36 ribosomal protein L36 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043268 [exp] 166 / 9e-55 AT5G20180 105 / 8e-31 Ribosomal protein L36 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G131000 [exp] 120 / 1e-36 AT5G20180 132 / 3e-41 Ribosomal protein L36 (.1.2) Potri.006G069000 [exp] 118 / 3e-36 AT5G20180 125 / 3e-39 Ribosomal protein L36 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00444 [flax] [poplar] Ribosomal_L36 Ribosomal protein L36
Representative CDS sequence Show only first row Show all	>Lus10019412 pacid=23181521 polypeptide=Lus10019412 locus=Lus10019412.g ID=Lus10019412.BGIv1.0 annot-version=v1.0 ATGAAGGTTAGATCTTCAGTGAAGAAGATGTGCGAGTTCTGCCAAGTAGTTAAGAGGCGGGGAAGAATCTATGTGCTTTGCAGCTCCAATCCTAAGCACA AGCAGCGACAAGGCATGTCCACCTTTGCCCATCAACAATCTACAGAGACCAATGTCGTCCGCACTCCTAACCATGGTGCAGGAATAGGTCTGCCTTCTCT GATACCTAAGAAGCAAGGACCTTCAATTGTTTTCGGATGGAGCGGGAGCCTTGCATCTCTCCTCTTCGGGCAAAGGAAGTAG
AA sequence Show only first row Show all	>Lus10019412 pacid=23181521 polypeptide=Lus10019412 locus=Lus10019412.g ID=Lus10019412.BGIv1.0 annot-version=v1.0 MKVRSSVKKMCEFCQVVKRRGRIYVLCSSNPKHKQRQGMSTFAHQQSTETNVVRTPNHGAGIGLPSLIPKKQGPSIVFGWSGSLASLLFGQRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G20180			Ribosomal protein L36 (.1.2)		Lus10019412 [exp]	0	1
AT3G07640			unknown protein		Lus10041098 [exp]	1.4	0.8224
AT4G38370			Phosphoglycerate mutase family...		Lus10023935 [exp]	2.4	0.7942
AT3G12390			Nascent polypeptide-associated...		Lus10026133 [exp]	2.6	0.8232
AT2G35605			SWIB/MDM2 domain superfamily p...		Lus10033312 [exp]	7.1	0.7622
AT2G31490			unknown protein		Lus10027603 [exp]	7.9	0.7865
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10006867 [exp]	9.5	0.8034
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10041349 [exp]	10.0	0.8022
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10023702 [exp]	12.5	0.7740
AT1G51510		Y14	RNA-binding (RRM/RBD/RNP motif...		Lus10003632 [exp]	13.3	0.7793
AT2G43780			unknown protein		Lus10035718 [exp]	13.4	0.7755

Compare expression of checked genes

Lus10019412 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.