Lus10019419 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22260 46 / 8e-07 AtZYP1a, ZYP1a Myosin heavy chain-related protein (.1)
AT1G22275 45 / 2e-06 ZYP1b Myosin heavy chain-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032798 128 / 2e-35 AT1G22260 575 / 0.0 Myosin heavy chain-related protein (.1)
Lus10010242 126 / 9e-35 AT1G22275 279 / 5e-83 Myosin heavy chain-related protein (.1)
Lus10041143 124 / 3e-34 AT1G22260 451 / 8e-148 Myosin heavy chain-related protein (.1)
Lus10036517 119 / 3e-32 AT1G22260 663 / 0.0 Myosin heavy chain-related protein (.1)
Lus10030096 41 / 1e-05 AT1G22275 47 / 4e-07 Myosin heavy chain-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G096400 58 / 7e-11 AT1G22275 786 / 0.0 Myosin heavy chain-related protein (.1)
PFAM info
Representative CDS sequence
>Lus10019419 pacid=23181589 polypeptide=Lus10019419 locus=Lus10019419.g ID=Lus10019419.BGIv1.0 annot-version=v1.0
ATGAAGAATTCCTCGATTTGCAGTCCAGAAGTTGGACAAAGTAAAGAGTGGACTGAGATTGACCAAGAACAACTTGTGCAGAAACTAGCAAGGCTGGAAG
AGGAATACAGAGACAGCACAGGAAAGTTGCAGGCGGATATACAGAAAAAGATAGATGAAATCGATGAACTTCAAAATATGGTGCAAGAAAAGGAAGAAAT
TATTCTGCAAGGCAAGGAGAGCAATAGAAAGTTGGAAGATCAAATCAATGAGCTCAAGGCATCATTAACCACAGCTGAAAGCAGACTTGTGGAAGTAGGG
AAGCAATCTGAAGTGATGTGTCACCAAAACGAACAGGAGCTCCTTTGGGAGTGA
AA sequence
>Lus10019419 pacid=23181589 polypeptide=Lus10019419 locus=Lus10019419.g ID=Lus10019419.BGIv1.0 annot-version=v1.0
MKNSSICSPEVGQSKEWTEIDQEQLVQKLARLEEEYRDSTGKLQADIQKKIDEIDELQNMVQEKEEIILQGKESNRKLEDQINELKASLTTAESRLVEVG
KQSEVMCHQNEQELLWE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22260 AtZYP1a, ZYP1a Myosin heavy chain-related pro... Lus10019419 0 1
AT1G12570 Glucose-methanol-choline (GMC)... Lus10002957 4.0 1.0000
AT3G20760 Nse4, component of Smc5/6 DNA ... Lus10004185 5.7 1.0000
Lus10010778 7.1 1.0000
Lus10009800 8.0 1.0000
AT5G42650 CYP74A, AOS, DD... DELAYED DEHISCENCE 2, CYTOCHRO... Lus10021019 8.1 0.9661
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004529 10.2 1.0000
Lus10011848 12.0 1.0000
Lus10011061 13.0 1.0000
AT3G25050 XTH3 xyloglucan endotransglucosylas... Lus10011845 14.1 1.0000
AT2G28320 Pleckstrin homology (PH) and l... Lus10023522 14.4 1.0000

Lus10019419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.