Lus10019432 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20140 187 / 1e-61 ASK4 SKP1-like 4 (.1)
AT2G25700 182 / 1e-59 ASK3 SKP1-like 3 (.1)
AT5G42190 180 / 6e-59 SKP1B, ASK2 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1)
AT4G34210 179 / 9e-59 ASK11 SKP1-like 11 (.1)
AT1G75950 178 / 2e-58 UIP1, SKP1A, ATSKP1, ASK1, SKP1 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1)
AT4G34470 178 / 2e-58 ASK12 SKP1-like 12 (.1)
AT3G60010 170 / 3e-55 ASK13 SKP1-like 13 (.1)
AT3G60020 166 / 1e-53 ASK5 SKP1-like 5 (.1)
AT2G03170 166 / 2e-53 ASK14 SKP1-like 14 (.1)
AT3G21850 163 / 2e-52 ASK9 SKP1-like 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005610 189 / 3e-62 AT5G42190 261 / 2e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1)
Lus10017282 188 / 3e-62 AT5G42190 259 / 6e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1)
Lus10017281 188 / 4e-62 AT5G42190 259 / 4e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1)
Lus10019794 188 / 4e-62 AT1G75950 241 / 8e-83 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1)
Lus10013575 186 / 4e-61 AT1G75950 255 / 2e-88 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1)
Lus10041874 182 / 1e-59 AT4G34210 201 / 3e-67 SKP1-like 11 (.1)
Lus10014115 186 / 3e-56 AT1G68010 700 / 0.0 hydroxypyruvate reductase (.1.2)
Lus10002803 164 / 1e-52 AT1G20140 189 / 3e-62 SKP1-like 4 (.1)
Lus10043288 121 / 3e-36 AT2G25700 62 / 4e-19 SKP1-like 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G135800 193 / 3e-64 AT1G20140 215 / 9e-73 SKP1-like 4 (.1)
Potri.002G018700 192 / 6e-64 AT5G42190 249 / 6e-86 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1)
Potri.005G243100 191 / 2e-63 AT1G75950 244 / 2e-84 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1)
Potri.004G175900 190 / 8e-63 AT5G42190 245 / 2e-84 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1)
Potri.005G109900 186 / 2e-61 AT5G42190 249 / 5e-86 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1)
Potri.012G085200 142 / 3e-44 AT4G34210 157 / 7e-50 SKP1-like 11 (.1)
Potri.005G094800 120 / 6e-35 AT3G21860 114 / 2e-32 SKP1-like 10 (.1)
Potri.012G086900 108 / 1e-30 AT4G34210 130 / 1e-39 SKP1-like 11 (.1)
Potri.001G132300 100 / 1e-27 AT1G75950 122 / 3e-36 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1)
Potri.016G028300 81 / 1e-19 AT2G03170 79 / 6e-19 SKP1-like 14 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0033 POZ PF03931 Skp1_POZ Skp1 family, tetramerisation domain
CL0033 PF01466 Skp1 Skp1 family, dimerisation domain
Representative CDS sequence
>Lus10019432 pacid=23181600 polypeptide=Lus10019432 locus=Lus10019432.g ID=Lus10019432.BGIv1.0 annot-version=v1.0
ATGTCGTTCACCCTGAAGAGCAGCGACGGGAAGTTGTTCCAAGTAGACGAGGCGGTGGCTATGGAATCGCAGACAATCAAGAACCTAATTGAGGATGGTT
GTGCTGACGACGAAATTCCCATCACCAACGTCACCGCCCATACATTGGCTCTAGTGATCGACTACTGCAAGAAGCACACCGACAACAACATCGCCAATAA
CAGCGAGGATCTGAAACAGTGGGACGCCGAGTTCATGAAAGTGGATCAGGCTACGCTCTACGACATTACAATGGCTGCCAACTATCTGAACATCAAGGGG
CTGTTGGATCTCGCATGCCAAATTGTGGCAAACAGCATCAAGGGAAAGACTCCACAGCAAATAAGGGACCATTACGGCATCCAAAACGACTTCTCCCCAG
AGGAGGAGGAAAAGATTCGCAGGGAGAACCAGTGGGCATTTGAATGA
AA sequence
>Lus10019432 pacid=23181600 polypeptide=Lus10019432 locus=Lus10019432.g ID=Lus10019432.BGIv1.0 annot-version=v1.0
MSFTLKSSDGKLFQVDEAVAMESQTIKNLIEDGCADDEIPITNVTAHTLALVIDYCKKHTDNNIANNSEDLKQWDAEFMKVDQATLYDITMAANYLNIKG
LLDLACQIVANSIKGKTPQQIRDHYGIQNDFSPEEEEKIRRENQWAFE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20140 ASK4 SKP1-like 4 (.1) Lus10019432 0 1
AT3G20300 Protein of unknown function (D... Lus10002334 6.3 0.8427
AT5G27000 KATD, ATK4 KINESIN-LIKE PROTEIN IN ARABID... Lus10029865 8.4 0.8478
AT5G22090 Protein of unknown function (D... Lus10013353 10.1 0.8482
AT4G25300 2-oxoglutarate (2OG) and Fe(II... Lus10004581 14.1 0.8474
AT1G09170 P-loop nucleoside triphosphate... Lus10020682 16.6 0.8406
AT5G44670 Domain of unknown function (DU... Lus10038387 20.4 0.8421
AT1G20640 NLP4 Plant regulator RWP-RK family ... Lus10012257 20.8 0.8006
AT4G19370 Protein of unknown function (D... Lus10035672 21.6 0.8228
AT4G26140 BGAL12 beta-galactosidase 12 (.1.2) Lus10028848 21.7 0.8329
AT1G63300 Myosin heavy chain-related pro... Lus10038860 22.1 0.7927

Lus10019432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.