Plant FIBer expression Database

Lus10019434 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25940 74 / 2e-18 early nodulin-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043290
[exp]
172 / 3e-57 AT5G25940 76 / 3e-19 early nodulin-related (.1)
Lus10030052
[exp]
134 / 3e-42 AT5G25940 74 / 3e-18 early nodulin-related (.1)
Lus10033027
[exp]
129 / 3e-40 AT5G25940 69 / 2e-16 early nodulin-related (.1)
Lus10002236
[exp]
61 / 3e-13 AT5G25940 82 / 3e-21 early nodulin-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G184000
[exp]
134 / 3e-42 AT5G25940 74 / 4e-18 early nodulin-related (.1)
Potri.009G143800
[exp]
127 / 2e-39 AT5G25940 65 / 1e-14 early nodulin-related (.1)
Potri.019G033700
[exp]
77 / 1e-19 AT5G25940 68 / 1e-15 early nodulin-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03386 ENOD93 Early nodulin 93 ENOD93 protein
Representative CDS sequence
>Lus10019434 pacid=23181494 polypeptide=Lus10019434 locus=Lus10019434.g ID=Lus10019434.BGIv1.0 annot-version=v1.0
ATGACAAAGAATGTGGCTGAGTCTCCCTCTCTGGACACTAGCATGTCTTTCCATGACCAAAGGTTGGCCATGGCTAAGCAATGCTCTCATGAGGGTGTGG
TTGCTGGAGCAAAGGCAGCTGTAATTGCTGGCATAGCTACTGCTATCCCAACTATGGCGAGTGCAAGGATGCTTCCATGGGCAAGAGCTAATCTCAACTA
CACTGCTCAAGCTCTCATCATATCCACAGTTGCTGGAGCGGCGTATTTCATAGTTGCTGACAAAACTGTGCTGGCTACTGCAAGAAAGAACTCTTTCAAG
CATGCTGCTAACAACTGA
AA sequence
>Lus10019434 pacid=23181494 polypeptide=Lus10019434 locus=Lus10019434.g ID=Lus10019434.BGIv1.0 annot-version=v1.0
MTKNVAESPSLDTSMSFHDQRLAMAKQCSHEGVVAGAKAAVIAGIATAIPTMASARMLPWARANLNYTAQALIISTVAGAAYFIVADKTVLATARKNSFK
HAANN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25940 early nodulin-related (.1) Lus10019434
[exp]
0 1
AT4G26270 PFK3 phosphofructokinase 3 (.1) Lus10006032
[exp]
1.0 0.9704
AT5G44730 Haloacid dehalogenase-like hyd... Lus10015451
[exp]
2.0 0.9617
AT4G14300 RNA-binding (RRM/RBD/RNP motif... Lus10011783
[exp]
2.6 0.9538
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10021051
[exp]
5.3 0.9566
AT4G05390 ATRFNR1 root FNR 1 (.1.2) Lus10038538
[exp]
6.7 0.9554
AT3G55010 EMB2818, ATPURM... EMBRYO DEFECTIVE 2818, phospho... Lus10024142
[exp]
7.5 0.9426
AT5G55410 Bifunctional inhibitor/lipid-t... Lus10032575
[exp]
7.9 0.9585
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Lus10036976
[exp]
8.5 0.9529
AT3G58180 ARM repeat superfamily protein... Lus10006688
[exp]
9.8 0.9313
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Lus10015826
[exp]
9.8 0.9530

Lus10019434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.