Lus10019437 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17486 241 / 2e-80 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 226 / 2e-74 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 204 / 3e-65 PPPDE putative thiol peptidase family protein (.1.2)
AT5G25170 188 / 5e-60 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 186 / 1e-58 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 188 / 2e-55 unknown protein
AT1G80690 170 / 9e-53 PPPDE putative thiol peptidase family protein (.1)
AT4G25680 73 / 4e-15 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 71 / 2e-14 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 67 / 5e-13 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043293 479 / 3e-174 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10013657 349 / 5e-123 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10033030 328 / 2e-114 AT4G17486 225 / 3e-74 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040170 241 / 1e-80 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004755 229 / 6e-76 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10007844 226 / 9e-75 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004372 216 / 4e-67 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1)
Lus10032708 201 / 1e-64 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 201 / 2e-64 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G154400 322 / 2e-112 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2)
Potri.018G070600 320 / 1e-111 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 252 / 9e-85 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 249 / 2e-83 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.002G134200 208 / 2e-67 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 206 / 1e-66 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 204 / 7e-66 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 203 / 2e-65 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 201 / 2e-64 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.018G021700 200 / 2e-64 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10019437 pacid=23181565 polypeptide=Lus10019437 locus=Lus10019437.g ID=Lus10019437.BGIv1.0 annot-version=v1.0
ATGGGGGCTGCTTCAGAAGCAATCTTGGATCATTCCAGCTCCGAGAAGGAGAATTCCGACGAAAGCGCCGAAACTCTGGTCTTGTTAAACGTCTACGACC
TCACCTCTGTTAACAATTACACTTATTGGTTCGGCTTTGGGATTTTCCACTCCGGCATTGAAGTTCGTGGTAAAGAGTATGGCTTTGGAGCTCATGATTT
CCCGATTAGTGGAGTGTTTGAAGTTGAGCCAAGAAACTGCCCAGGTTTCATTTACAGATGCTCCATCCCACTAGGGCTCATATCAATGCATCATAGTGAG
TTGAGGACATTCATGGAGAGGATGGCTTCTGAGTATCACGGTGACACGTACCACCTCATCTCCAAGAACTGCAACCATTTTACAGATGATGTCAGCTACC
GGTTGGTTGGAAAGAGCATACCGGGTTTCGTAAACCGACTTGCCCGGCTTGGTGCTCTATGTAGTTGTTTGCTTCCCGAAAGCCTTCAAGTTACTGCAGT
GAAACAACTACCTGAACACCATGACTTTTTGGAAGAAGATGGAAGTGAGTCTGTGACAACTGCCTCCCCGTCGTGTGGGTCTACAGAAATCGACGACGAG
GATGAAGATAAGCATCTGTTGTCACCAAGGAATGGAGCTTCTGGAGAAATCTCATTTGTGAAAGAGAGATGTGGGACGGAAAACAAGCCACCTCCATTAC
AAGAATTTGTGAGCAGAAGAAATGGGATAGAATAG
AA sequence
>Lus10019437 pacid=23181565 polypeptide=Lus10019437 locus=Lus10019437.g ID=Lus10019437.BGIv1.0 annot-version=v1.0
MGAASEAILDHSSSEKENSDESAETLVLLNVYDLTSVNNYTYWFGFGIFHSGIEVRGKEYGFGAHDFPISGVFEVEPRNCPGFIYRCSIPLGLISMHHSE
LRTFMERMASEYHGDTYHLISKNCNHFTDDVSYRLVGKSIPGFVNRLARLGALCSCLLPESLQVTAVKQLPEHHDFLEEDGSESVTTASPSCGSTEIDDE
DEDKHLLSPRNGASGEISFVKERCGTENKPPPLQEFVSRRNGIE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17486 PPPDE putative thiol peptidase... Lus10019437 0 1
AT2G26730 Leucine-rich repeat protein ki... Lus10001900 3.3 0.8537
AT1G60010 unknown protein Lus10029193 4.5 0.8014
AT4G17486 PPPDE putative thiol peptidase... Lus10043293 6.3 0.8252
AT5G03530 ATRABALPHA, AtR... ARABIDOPSIS THALIANA RAB GTPAS... Lus10023910 6.3 0.7934
AT5G24550 BGLU32 beta glucosidase 32 (.1) Lus10012871 8.5 0.8513
AT5G35670 IQD33 IQ-domain 33 (.1) Lus10000919 12.4 0.7969
AT5G24550 BGLU32 beta glucosidase 32 (.1) Lus10012868 14.8 0.8262
AT3G29680 HXXXD-type acyl-transferase fa... Lus10029798 15.9 0.7995
AT4G00620 EMB3127 EMBRYO DEFECTIVE 3127, Amino a... Lus10012502 16.3 0.7609
AT2G02950 PKS1 phytochrome kinase substrate 1... Lus10024228 17.1 0.8221

Lus10019437 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.