Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20045 62 / 1e-14 unknown protein AT5G07490 45 / 4e-07 unknown protein AT2G35658 44 / 5e-07 unknown protein AT5G61630 44 / 1e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043296 [exp] 100 / 1e-28 AT1G68680 83 / 2e-21 unknown protein Lus10042998 [exp] 52 / 1e-09 AT5G07490 117 / 2e-34 unknown protein Lus10032501 [exp] 48 / 3e-08 AT5G61630 129 / 2e-39 unknown protein Lus10011000 [exp] 40 / 2e-05 AT2G35658 74 / 5e-18 unknown protein Lus10000594 [exp] 39 / 3e-05 AT2G35658 79 / 1e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G015800 [exp] 62 / 2e-14 AT5G20045 57 / 3e-12 unknown protein Potri.008G015100 [exp] 57 / 2e-12 AT5G20045 52 / 3e-10 unknown protein Potri.003G081900 [exp] 44 / 3e-07 AT2G35658 84 / 3e-23 unknown protein Potri.001G080500 [exp] 45 / 4e-07 AT5G61630 155 / 2e-49 unknown protein Potri.001G152700 [exp] 40 / 8e-06 AT2G35658 81 / 1e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019440 pacid=23181611 polypeptide=Lus10019440 locus=Lus10019440.g ID=Lus10019440.BGIv1.0 annot-version=v1.0 ATGTATAGATCTTCCAGCACTTTCCGTCCCTCTGATGAATACCTCCTCAACTTGTCATGTTCAGCTCCTACGGTGACTACTGGGTCGCCTCTGAAAGTGG TGGTGGTTTCCTCCGCTGATTGTTCCGAAGGGAGCAAGAAGGAAGTTGATCTGCAACGACAGAAGCTGGGAGGGGAAAATGCAGTTCACCTCATCCCACT TGTTATCTTTCTCTGTGGTTTCATTCTATGGCTCTTCTCTCGTCCTTGA
AA sequence Show only first row Show all	>Lus10019440 pacid=23181611 polypeptide=Lus10019440 locus=Lus10019440.g ID=Lus10019440.BGIv1.0 annot-version=v1.0 MYRSSSTFRPSDEYLLNLSCSAPTVTTGSPLKVVVVSSADCSEGSKKEVDLQRQKLGGENAVHLIPLVIFLCGFILWLFSRP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G20045			unknown protein		Lus10019440 [exp]	0	1
AT5G50740			Heavy metal transport/detoxifi...		Lus10030514 [exp]	2.2	0.9513
AT1G34110			Leucine-rich receptor-like pro...		Lus10000509 [exp]	2.4	0.9378
AT3G03420			Ku70-binding family protein (....		Lus10014579 [exp]	2.4	0.9355
AT1G74040		IPMS2, MAML-3, ...	SOPROPYLMALATE SYNTHASE 2, 2-i...		Lus10019573 [exp]	3.5	0.9386
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Lus10042287 [exp]	6.5	0.9126
AT4G19710		AK-HSDHII, AK-H...	aspartate kinase-homoserine de...		Lus10030339 [exp]	6.9	0.9351
AT3G28730		NFD, SSRP1, ATH...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10042065 [exp]	7.1	0.9357
AT5G24318			O-Glycosyl hydrolases family 1...		Lus10040808 [exp]	8.0	0.9374
AT4G26190			Haloacid dehalogenase-like hyd...		Lus10034676 [exp]	9.8	0.9280
AT5G60700			glycosyltransferase family pro...		Lus10037396 [exp]	10.4	0.9346

Compare expression of checked genes

Lus10019440 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.