Lus10019444 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 64 / 1e-13 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT4G30380 52 / 4e-09 EXLB2 Barwin-related endoglucanase (.1)
AT1G65680 40 / 0.0002 ATHEXPBETA1.4, ATEXPB2 expansin B2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033054 168 / 1e-54 AT2G18660 56 / 1e-10 plant natriuretic peptide A (.1)
Lus10013118 150 / 1e-47 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1)
Lus10017763 110 / 2e-32 ND 35 / 0.001
Lus10030078 92 / 4e-24 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
Lus10042435 68 / 4e-15 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10019978 57 / 7e-11 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10026232 56 / 2e-10 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10020130 54 / 2e-09 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10026930 54 / 2e-09 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G155000 153 / 1e-48 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Potri.018G031901 149 / 5e-47 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G249500 145 / 2e-45 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.018G029100 101 / 3e-28 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G252200 100 / 4e-28 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.003G218300 67 / 6e-15 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.018G098200 65 / 2e-14 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.018G101600 53 / 1e-09 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G176300 53 / 1e-09 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.006G179300 53 / 1e-09 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10019444 pacid=23181517 polypeptide=Lus10019444 locus=Lus10019444.g ID=Lus10019444.BGIv1.0 annot-version=v1.0
ATGTCGAGGCTTCTCCTTCTCTCCATCTCCTTCCTCTTCACCATTCTGCATCTCCCTTTCTCCTCCCTCGCCGATATCGGCACCGCCGCCTGGTACGCTC
CTCCTTATTCCCCGACGGCGTGCTACGGCGGCGACGCCTCCCAGTTCCCGTCTAGCAATCTCTTCGCGGCGGCCGGGGAAGGGATATGGGACAATGGAGC
AGGGTGCGGGAGGCAGTACAAGGTTCGGTGTATCAGCGCGGTGGCGACTGGATCCTGTAATCCTAGCCAGACGATTCAGGTGAGGATCGTTGACCACGCG
TCATCCTTGGTCTCTGCGCCTTCGGCCGGCGGAACCACCATCGTCCTGTCCCAGACGGCGTTCGGAACAGTCGCGAATTGGACCGCTAGCAACAACATCA
ACATTGAGATCGAAAAGTAA
AA sequence
>Lus10019444 pacid=23181517 polypeptide=Lus10019444 locus=Lus10019444.g ID=Lus10019444.BGIv1.0 annot-version=v1.0
MSRLLLLSISFLFTILHLPFSSLADIGTAAWYAPPYSPTACYGGDASQFPSSNLFAAAGEGIWDNGAGCGRQYKVRCISAVATGSCNPSQTIQVRIVDHA
SSLVSAPSAGGTTIVLSQTAFGTVANWTASNNINIEIEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10019444 0 1
AT4G10770 ATOPT7 ARABIDOPSIS THALIANA OLIGOPEPT... Lus10028445 2.0 0.8023
AT3G53810 Concanavalin A-like lectin pro... Lus10001562 3.5 0.7427
AT2G37570 SLT1 sodium- and lithium-tolerant 1... Lus10024406 6.7 0.7937
AT3G11820 PEN1, AT-SYR1, ... PENETRATION1, SYNTAXIN RELATED... Lus10029373 6.8 0.7981
AT1G55190 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, ... Lus10008598 8.1 0.7487
AT1G69510 cAMP-regulated phosphoprotein ... Lus10030448 9.5 0.7791
AT1G59960 NAD(P)-linked oxidoreductase s... Lus10029208 10.0 0.7247
AT1G08770 PRA1.E prenylated RAB acceptor 1.E (.... Lus10024861 13.0 0.7122
AT3G18830 ATPMT5, AtPLT5 ARABIDOPSIS THALIANA POLYOL/MO... Lus10026329 14.1 0.7626
AT3G18830 ATPMT5, AtPLT5 ARABIDOPSIS THALIANA POLYOL/MO... Lus10026328 16.0 0.7316

Lus10019444 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.