Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043307 [exp] 161 / 7e-53 ND 35 / 0.003 Lus10038429 [exp] 155 / 4e-50 AT2G18370 44 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038428 [exp] 79 / 3e-20 ND / Lus10038430 [exp] 76 / 8e-19 ND 37 / 7e-04
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019456 pacid=23181599 polypeptide=Lus10019456 locus=Lus10019456.g ID=Lus10019456.BGIv1.0 annot-version=v1.0 ATGAAGAACAACAACATCAGCATAACATTCTCTTTTGTCGTGATCATGATTTGCCTAAGCAGCAGCAGCAGCATCAACATTAGTGAAGCAGCCAGACTTC CGACCGACGACTCCTCAAATTGTGCTACTTACCAAAGCAAAGTCCCTGACTGCGTCACCTATTTGGGTAGTAAGAATACCACCCCGCCTCAGAGCTGCTG CACACAGCTTAAGAAACTACTAGCCCCACCGGCAGACCAACTGATACCGGTCTGTACATGCATGAAACCGGTTTTCGCGAGCAATTCTAAGGCCGGTACT ATTGTCACGGGGTGCAATGCTCAGACTGAGGTCGCTAAGTGCAAATAA
AA sequence Show only first row Show all	>Lus10019456 pacid=23181599 polypeptide=Lus10019456 locus=Lus10019456.g ID=Lus10019456.BGIv1.0 annot-version=v1.0 MKNNNISITFSFVVIMICLSSSSSINISEAARLPTDDSSNCATYQSKVPDCVTYLGSKNTTPPQSCCTQLKKLLAPPADQLIPVCTCMKPVFASNSKAGT IVTGCNAQTEVAKCK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019456 [exp]	0	1
AT1G10385			Vps51/Vps67 family (components...		Lus10033648 [exp]	2.0	0.9125
AT1G08315			ARM repeat superfamily protein...		Lus10006007 [exp]	2.4	0.9021
AT5G61890	AP2_ERF		Integrase-type DNA-binding sup...		Lus10022426 [exp]	2.4	0.8846
AT5G01750			Protein of unknown function (D...		Lus10007360 [exp]	3.7	0.8053
AT5G14870		ATCNGC18	cyclic nucleotide-gated channe...		Lus10039415 [exp]	4.5	0.8291
AT1G10385			Vps51/Vps67 family (components...		Lus10017692 [exp]	8.9	0.8468
AT1G28270		RALFL4	ralf-like 4 (.1)		Lus10015431 [exp]	9.2	0.7739
AT5G41600		RTNLB4, BTI3	Reticulan like protein B4, VIR...		Lus10002188 [exp]	10.7	0.8098
AT4G10260			pfkB-like carbohydrate kinase ...		Lus10040562 [exp]	12.6	0.6962
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10008978 [exp]	14.4	0.8048

Compare expression of checked genes

Lus10019456 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.