Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24960 139 / 7e-39 CYP71A14 "cytochrome P450, family 71, subfamily A, polypeptide 14", cytochrome P450, family 71, subfamily A, polypeptide 14 (.1) AT3G48320 139 / 9e-39 CYP71A21 "cytochrome P450, family 71, subfamily A, polypeptide 21", cytochrome P450, family 71, subfamily A, polypeptide 21 (.1) AT3G48270 135 / 2e-37 CYP71A26 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) AT3G48290 135 / 3e-37 CYP71A24 "cytochrome P450, family 71, subfamily A, polypeptide 24", cytochrome P450, family 71, subfamily A, polypeptide 24 (.1.2) AT5G24950 134 / 5e-37 CYP71A15 "cytochrome P450, family 71, subfamily A, polypeptide 15", cytochrome P450, family 71, subfamily A, polypeptide 15 (.1) AT4G13310 132 / 6e-37 CYP71A20 "cytochrome P450, family 71, subfamily A, polypeptide 20", cytochrome P450, family 71, subfamily A, polypeptide 20 (.1.2) AT2G30770 134 / 1e-36 CYP71A13 cytochrome P450, family 71, subfamily A, polypeptide 13 (.1) AT3G48310 133 / 2e-36 CYP71A22 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) AT1G11610 132 / 4e-36 CYP71A18 "cytochrome P450, family 71, subfamily A, polypeptide 18", cytochrome P450, family 71, subfamily A, polypeptide 18 (.1.2) AT2G30750 130 / 2e-35 CYP71A12 cytochrome P450, family 71, subfamily A, polypeptide 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043311 [exp] 295 / 1e-102 AT3G48320 159 / 6e-46 "cytochrome P450, family 71, subfamily A, polypeptide 21", cytochrome P450, family 71, subfamily A, polypeptide 21 (.1) Lus10017961 [exp] 140 / 4e-39 AT3G48280 502 / 4e-175 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10041951 [exp] 140 / 5e-39 AT3G48280 519 / 0.0 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10029787 [exp] 138 / 2e-38 AT3G48310 407 / 7e-138 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) Lus10016601 [exp] 138 / 4e-38 AT3G26320 402 / 6e-136 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1) Lus10019459 [exp] 136 / 1e-37 AT2G30770 409 / 3e-138 cytochrome P450, family 71, subfamily A, polypeptide 13 (.1) Lus10043310 [exp] 134 / 3e-37 AT2G30770 329 / 4e-109 cytochrome P450, family 71, subfamily A, polypeptide 13 (.1) Lus10043313 [exp] 130 / 4e-35 AT3G48280 390 / 3e-131 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10043308 [exp] 129 / 5e-35 AT3G48280 463 / 5e-160 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G085600 [exp] 172 / 7e-51 AT3G48270 378 / 1e-126 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) Potri.012G089600 [exp] 164 / 6e-48 AT3G48310 387 / 6e-130 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) Potri.016G137600 [exp] 149 / 2e-42 AT3G48270 401 / 2e-135 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) Potri.015G086000 [exp] 145 / 8e-41 AT1G13080 434 / 2e-148 "cytochrome P450, family 71, subfamily B, polypeptide 2", cytochrome P450, family 71, subfamily B, polypeptide 2 (.1.2) Potri.012G090000 [exp] 143 / 3e-40 AT3G26330 433 / 5e-148 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Potri.012G089900 [exp] 143 / 4e-40 AT3G48280 429 / 1e-146 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.007G074850 [exp] 137 / 6e-38 AT3G26300 379 / 1e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.015G085800 [exp] 137 / 9e-38 AT3G48270 479 / 7e-166 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) Potri.007G074900 [exp] 136 / 1e-37 AT3G26300 383 / 3e-128 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G131051 [exp] 129 / 8e-36 AT3G48280 218 / 9e-67 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10019460 pacid=23181561 polypeptide=Lus10019460 locus=Lus10019460.g ID=Lus10019460.BGIv1.0 annot-version=v1.0 ATGGAGCTTCCCATGATCATTTTCCCACTCCTCTTCCTGATTCCCCTGTTTTTCTTCCTCAAATCCAGAAGAAACTCCAACAAAACCCAACTCAACCTCC CACCTTCACCGCCGACTCTGCCACTCATCGGAAACCTCCACCAAGTCGGCGCCGTCCCATACCGCTCCCTCAAATCCCTCGCCGACAAGTACGGCTCCCT AATGCTCCTCCATTTCGGCAGCGCCCCCACCGTCGTCGTCTCCTCCGCGCAGGTAGCCGAAGTCATCACTAGAGACCACGACGTCGTCTTCGCCGACCGG CCGCGTCTCAGCGTCGCCAACATCTTCTTCTTCGGGTGGAGCGACCTCGCCTTCTGCCCTTACGGCGAGTACTGGAGGCAGGTGAAGAAGATCTGCGTCC TCGAGCTCCTCAGCCAGAAGCGAGTCCAGGGTTTCGACTTCGTCAGGGAGGAAGAGACCGACAATTTGGTCGAGGAGATCTCCGCCTCGTTTAGTGGCCG AGATCTCCGCCGCCGGCCGCCGCGGCGAATCCGTCGACCTCAGCGAGCTTTTGGTTTCGATCTCGAACAACATCGTGTCCAGATCTGCTCTGGGCCGGAC TTATACCAAGAGCGAGGATGGTGA
AA sequence Show only first row Show all	>Lus10019460 pacid=23181561 polypeptide=Lus10019460 locus=Lus10019460.g ID=Lus10019460.BGIv1.0 annot-version=v1.0 MELPMIIFPLLFLIPLFFFLKSRRNSNKTQLNLPPSPPTLPLIGNLHQVGAVPYRSLKSLADKYGSLMLLHFGSAPTVVVSSAQVAEVITRDHDVVFADR PRLSVANIFFFGWSDLAFCPYGEYWRQVKKICVLELLSQKRVQGFDFVREEETDNLVEEISASFSGRDLRRRPPRRIRRPQRAFGFDLEQHRVQICSGPD LYQERGW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48320		CYP71A21	"cytochrome P450, family 71, s...		Lus10019460 [exp]	0	1
AT3G26230		CYP71B24	"cytochrome P450, family 71, s...		Lus10019461 [exp]	1.0	0.9979
AT3G26330		CYP71B37	"cytochrome P450, family 71, s...		Lus10033633 [exp]	1.4	0.9966
					Lus10014508 [exp]	2.0	0.9954
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10025902 [exp]	3.9	0.9955
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10034626 [exp]	4.5	0.9926
					Lus10005629 [exp]	4.6	0.9938
AT5G43440			2-oxoglutarate (2OG) and Fe(II...		Lus10022192 [exp]	4.9	0.9940
AT3G26330		CYP71B37	"cytochrome P450, family 71, s...		Lus10012879 [exp]	5.9	0.9947
AT2G30770		CYP71A13	cytochrome P450, family 71, su...		Lus10019459 [exp]	7.3	0.9908
					Lus10024872 [exp]	8.1	0.9894

Compare expression of checked genes

Lus10019460 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.