Lus10019487 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47740 115 / 2e-31 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT5G65500 63 / 3e-11 U-box domain-containing protein kinase family protein (.1)
AT1G01680 61 / 1e-10 ATPUB54 plant U-box 54 (.1)
AT5G57035 56 / 7e-09 U-box domain-containing protein kinase family protein (.1)
AT5G61550 55 / 2e-08 U-box domain-containing protein kinase family protein (.1.2)
AT5G12000 52 / 9e-08 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT1G16760 52 / 2e-07 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT4G25160 49 / 1e-06 U-box domain-containing protein kinase family protein (.1)
AT1G78940 48 / 3e-06 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
AT2G07020 47 / 6e-06 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043338 365 / 3e-129 AT5G47740 128 / 2e-36 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10029567 111 / 2e-28 AT5G47740 187 / 4e-57 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10002238 110 / 2e-28 AT5G47740 183 / 2e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10040825 72 / 3e-14 AT2G45910 496 / 1e-163 U-box domain-containing protein kinase family protein (.1)
Lus10016557 68 / 6e-13 AT2G45910 508 / 3e-168 U-box domain-containing protein kinase family protein (.1)
Lus10033340 53 / 8e-08 AT1G16760 800 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10017145 50 / 6e-07 AT5G35380 207 / 3e-60 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10027592 49 / 1e-06 AT3G20200 175 / 2e-50 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10008542 49 / 2e-06 AT2G24370 823 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G084700 229 / 9e-76 AT5G47740 124 / 1e-34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.015G083100 221 / 1e-72 AT5G47740 112 / 5e-30 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.006G003900 122 / 2e-33 AT5G47740 215 / 3e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.001G239100 57 / 3e-09 AT2G45910 473 / 6e-156 U-box domain-containing protein kinase family protein (.1)
Potri.004G233000 52 / 2e-07 AT4G25160 874 / 0.0 U-box domain-containing protein kinase family protein (.1)
Potri.018G061600 49 / 1e-06 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Potri.007G001900 47 / 8e-06 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
Potri.006G225300 42 / 0.0002 AT5G12000 749 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10019487 pacid=23181542 polypeptide=Lus10019487 locus=Lus10019487.g ID=Lus10019487.BGIv1.0 annot-version=v1.0
ATGGAAATCGAAGGACAGTCGCCGGCGGCGGGCCGCAGCAGCAGTTCGTTCCAGTACAGTAAATCAAGGGTGATGTCGTCTGAAATTGTGGAGATTGCTG
ATTTGGAAGACAATAATATCAACAATCACAGTAGCAGCAGCAGGAGGAGTACTGGGATAGTGAATGATGTATATGTTTGTGTGGGGAGAGATGACATGGA
CGCCGTCAAATGGGCCGTCGATCATATCTCTTCACCTCCCTCTCGATTGTTCCTCGTCCACGTCTTCCCTCCCCTCCGCTACATCTCCACTCCAGTTGGA
AGATTGGCGAAGAACCAGCTGAGCAAAGACCAGTTGAGGTTTTACTCCAACGAGGAGAACAACAGGAGGAGGAATCTGTTGCACAAATACATCCGCTTCT
GTGATGATGCCAAGGTTCCGGTAGACACCATGTTGCTGGAGAGCGGTGAAACTGGGAAAGCCATACTTGATCTAATCCCTGTTCTCAACATCACCAATCT
CGTCCTTGGCGCAAAGCTTCCTCCTCTTCCGCGCTCCAGATTGATCAAGAAAGTCGGGAAAGCAGAGTTCGTCAAGAAGAATGCGCCAGATTACTGCCGG
GTCACCGTCGTTCACAAGGGGAAGGCTTTAACTGATGGTGTTCATAGAAGAATGGCATCATCATCATCCATTGCCAATCCTGAGAGGAAGTTTTTTTCAT
GCGCCTGCTTCTCTGGGAAAGTTTGA
AA sequence
>Lus10019487 pacid=23181542 polypeptide=Lus10019487 locus=Lus10019487.g ID=Lus10019487.BGIv1.0 annot-version=v1.0
MEIEGQSPAAGRSSSSFQYSKSRVMSSEIVEIADLEDNNINNHSSSSRRSTGIVNDVYVCVGRDDMDAVKWAVDHISSPPSRLFLVHVFPPLRYISTPVG
RLAKNQLSKDQLRFYSNEENNRRRNLLHKYIRFCDDAKVPVDTMLLESGETGKAILDLIPVLNITNLVLGAKLPPLPRSRLIKKVGKAEFVKKNAPDYCR
VTVVHKGKALTDGVHRRMASSSSIANPERKFFSCACFSGKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G47740 Adenine nucleotide alpha hydro... Lus10019487 0 1
AT5G47740 Adenine nucleotide alpha hydro... Lus10043338 1.0 0.8510
AT2G39700 ATHEXPALPHA1.6,... expansin A4 (.1) Lus10016533 3.5 0.8232
AT5G58530 Glutaredoxin family protein (.... Lus10007517 3.9 0.8193
AT1G30700 FAD-binding Berberine family p... Lus10038439 4.5 0.8010
AT5G44005 unknown protein Lus10008220 8.4 0.7994
AT1G62760 Plant invertase/pectin methyle... Lus10028910 10.6 0.7746
AT5G01880 RING/U-box superfamily protein... Lus10025228 11.8 0.7386
AT1G01900 SBTI1.1, ATSBT1... subtilase family protein (.1) Lus10041382 12.0 0.7822
AT3G06240 F-box family protein (.1) Lus10007040 16.2 0.6428
AT1G69080 Adenine nucleotide alpha hydro... Lus10036814 16.9 0.7467

Lus10019487 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.