Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63135 54 / 1e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G085100 [exp] 64 / 1e-14 AT5G63135 102 / 4e-30 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019491 pacid=23181556 polypeptide=Lus10019491 locus=Lus10019491.g ID=Lus10019491.BGIv1.0 annot-version=v1.0 ATGTTGCAGTTTCCAGCTTTCATGACGCAGTACCCATGGTCCACCAGGACGATCCCAGCCTCCAACCTCATGTCCTCGCAGCCGTCGCCCCACCCCCTTA CTGCAGAGCAGCTTCTCGCCATGGAAGAGGACGCTTACGAGGATCGGGTTTTGAGGCTGAGACCACAAACACGCCTTGCTTGTGGCCATGCTCCCTTGCA GGCAAGTGCCGCTGTGACTGAGGCTTCTCGCGAGGGGCCAAGCTACCCGCATGGTGTGCTCATCGATTGGCCTAAGCGAGTGATGCTAGAGGTTGAATAG
AA sequence Show only first row Show all	>Lus10019491 pacid=23181556 polypeptide=Lus10019491 locus=Lus10019491.g ID=Lus10019491.BGIv1.0 annot-version=v1.0 MLQFPAFMTQYPWSTRTIPASNLMSSQPSPHPLTAEQLLAMEEDAYEDRVLRLRPQTRLACGHAPLQASAAVTEASREGPSYPHGVLIDWPKRVMLEVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G63135			unknown protein		Lus10019491 [exp]	0	1
					Lus10004923 [exp]	1.7	0.8543
					Lus10016269 [exp]	4.2	0.8340
AT5G47570			unknown protein		Lus10008504 [exp]	17.8	0.7965
AT2G48020			Major facilitator superfamily ...		Lus10027977 [exp]	20.6	0.8404
					Lus10033923 [exp]	22.4	0.8334
AT3G52680			F-box/RNI-like/FBD-like domain...		Lus10029997 [exp]	24.2	0.8324
AT3G22880		ARLIM15, ATDMC1	ARABIDOPSIS THALIANA DISRUPTIO...		Lus10006625 [exp]	26.2	0.7570
					Lus10006316 [exp]	29.8	0.8270
					Lus10027007 [exp]	30.2	0.7505
AT5G41610		ATCHX18	cation/H+ exchanger 18, ARABID...		Lus10028748 [exp]	32.1	0.8266

Compare expression of checked genes

Lus10019491 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.