Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G053600 [exp] 39 / 0.0002 AT3G60220 148 / 1e-41 TOXICOS EN LEVADURA 4 (.1) Potri.002G140600 [exp] 37 / 0.0008 AT3G60220 194 / 3e-59 TOXICOS EN LEVADURA 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019496 pacid=23181514 polypeptide=Lus10019496 locus=Lus10019496.g ID=Lus10019496.BGIv1.0 annot-version=v1.0 ATGAGCTCGCGGCGGAGGTCGGGAGGAGCAGCTGGCTCAAGGACTGCGTTGACAGGCTGGGGGGGGGGGCTGTCGGCGTCGATGTCGTCGAGAGCGATGT CGTTTCGGAGCTCGGGTAGATTCTTCGGAGGGAGCAGCCGACGGAGCGTGGGCGAAGTAGTAATCGGAGCGGGAGATCAATTGTACGACGTGGAGGAAGG TAACAGTAGAATTGGGGAGGAAATCAGCGAATTCTTCCGTTGGTTCTCAGGGGTATGA
AA sequence Show only first row Show all	>Lus10019496 pacid=23181514 polypeptide=Lus10019496 locus=Lus10019496.g ID=Lus10019496.BGIv1.0 annot-version=v1.0 MSSRRRSGGAAGSRTALTGWGGGLSASMSSRAMSFRSSGRFFGGSSRRSVGEVVIGAGDQLYDVEEGNSRIGEEISEFFRWFSGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60220		ATL4	TOXICOS EN LEVADURA 4 (.1)		Lus10019496 [exp]	0	1
AT2G40435			unknown protein		Lus10025257 [exp]	2.2	0.8467
					Lus10025229 [exp]	4.2	0.8426
AT5G66800			unknown protein		Lus10009349 [exp]	5.3	0.8400
AT5G02130		NDP1	Tetratricopeptide repeat (TPR)...		Lus10024371 [exp]	5.8	0.8754
AT5G47500		PME5	pectin methylesterase 5, Pecti...		Lus10004720 [exp]	11.6	0.8634
AT4G30400			RING/U-box superfamily protein...		Lus10023206 [exp]	17.8	0.7877
AT5G66840			SAP domain-containing protein ...		Lus10008134 [exp]	20.8	0.8391
AT2G16030			S-adenosyl-L-methionine-depend...		Lus10039718 [exp]	21.2	0.7973
AT2G45260			Plant protein of unknown funct...		Lus10009923 [exp]	21.9	0.8517
AT5G27220			Frigida-like protein (.1)		Lus10033831 [exp]	24.5	0.8015

Compare expression of checked genes

Lus10019496 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.