Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46940 86 / 5e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46930 84 / 2e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G38610 81 / 5e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46960 75 / 7e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46950 73 / 3e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G02250 59 / 4e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G48020 56 / 5e-10 ATPMEI1 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1) AT3G17220 55 / 2e-09 ATPMEI2 pectin methylesterase inhibitor 2 (.1) AT5G64620 49 / 4e-07 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043346 [exp] 263 / 5e-91 AT5G46940 69 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10040119 [exp] 118 / 5e-32 AT5G46930 98 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001464 [exp] 68 / 3e-14 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10030926 [exp] 66 / 4e-14 AT5G46930 58 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10008201 [exp] 67 / 7e-14 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10017345 [exp] 63 / 2e-12 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1) Lus10001658 [exp] 61 / 2e-11 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1) Lus10020664 [exp] 57 / 3e-10 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10041650 [exp] 56 / 6e-10 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G044100 [exp] 171 / 2e-54 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086500 [exp] 119 / 1e-33 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086600 [exp] 116 / 7e-33 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 64 / 8e-13 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.008G102600 [exp] 62 / 3e-12 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.004G016500 [exp] 58 / 1e-10 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 54 / 6e-09 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G063000 [exp] 52 / 1e-08 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.002G191500 [exp] 44 / 2e-05 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G127700 [exp] 41 / 0.0004 AT2G45220 680 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10019498 pacid=23181593 polypeptide=Lus10019498 locus=Lus10019498.g ID=Lus10019498.BGIv1.0 annot-version=v1.0 ATGGAGGATCATCGCAATCGCCCGGTCCGTTCTCTTACGTTCTCACCCCTCTTCTTCATCGCCCTCCAATGCTGCCTCCTCGCAGATGCTTCCACTAATC ACAACATCATCATCTCTACCTGCAAGAAATCCGCCAATACCGATCCAAACATCTCCTACGACTTCTGCCTAACTTCCCTTCAAGCAGCCACCCGTCCAGG ATCCGACCCCAACCTCACCAAGCTAGCCGTCATCTCCATAAACTTGATCCGCCGGAATGCCACCAACACCAAGCGCTTCATCAACCACCTCCTCTCCTCT TCCACAATAGACCCTTACAATCAGGCTTGCTTGCAGGACTGCCTTCAGCTCTACTCCGACACCATACCTTCCCTCAAACCGGCCATCGTAAGCATCAAGT ATGGGTCCTTCGTGGATGCCAACATCAAGGTGGGTTCCGTTCTCGATGCATCTGCTACTTGTGAAGACCAGTTTGTCGACAAACCGGAGGATTCAGTCTC ACCACTAACGACGAGAAACAGAGATATATTCCAGCTCTGTGCAATCTCTCTGTCCATCATCAACATGCTCCGTATAGGCTGA
AA sequence Show only first row Show all	>Lus10019498 pacid=23181593 polypeptide=Lus10019498 locus=Lus10019498.g ID=Lus10019498.BGIv1.0 annot-version=v1.0 MEDHRNRPVRSLTFSPLFFIALQCCLLADASTNHNIIISTCKKSANTDPNISYDFCLTSLQAATRPGSDPNLTKLAVISINLIRRNATNTKRFINHLLSS STIDPYNQACLQDCLQLYSDTIPSLKPAIVSIKYGSFVDANIKVGSVLDASATCEDQFVDKPEDSVSPLTTRNRDIFQLCAISLSIINMLRIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G46970			Plant invertase/pectin methyle...		Lus10019498 [exp]	0	1
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10032347 [exp]	1.0	0.9721
AT2G36890	MYB	BIT1, ATMYB38, ...	REGULATOR OF AXILLARY MERISTEM...		Lus10023002 [exp]	2.0	0.9583
AT1G14190			Glucose-methanol-choline (GMC)...		Lus10032346 [exp]	2.4	0.9523
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036942 [exp]	3.9	0.9481
AT2G47460	MYB	PFG1, ATMYB12	PRODUCTION OF FLAVONOL GLYCOSI...		Lus10002435 [exp]	5.0	0.9208
AT5G45290			RING/U-box superfamily protein...		Lus10016428 [exp]	7.7	0.9508
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10019926 [exp]	8.4	0.9365
AT4G37980		ELI3-1, ATCAD7	CINNAMYL-ALCOHOL DEHYDROGENASE...		Lus10023268 [exp]	10.1	0.9468
AT5G44550			Uncharacterised protein family...		Lus10000781 [exp]	11.8	0.9320
AT2G36780			UDP-Glycosyltransferase superf...		Lus10012011 [exp]	13.7	0.9360

Compare expression of checked genes

Lus10019498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.