Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44610 188 / 7e-62 RAB6, AtRABH1b, AtRab6A Ras-related small GTP-binding family protein (.1) AT5G10260 179 / 1e-58 AtRABH1e RAB GTPase homolog H1E (.1) AT2G22290 166 / 2e-53 ATRAB6, ATRAB-H1D, AtRABH1d ARABIDOPSIS RAB GTPASE HOMOLOG 6, ARABIDOPSIS RAB GTPASE HOMOLOG H1D, RAB GTPase homolog H1D (.1) AT5G64990 149 / 1e-46 AtRABH1a RAB GTPase homolog H1A (.1.2) AT4G39890 144 / 2e-44 AtRABH1c RAB GTPase homolog H1C (.1) AT5G45130 70 / 6e-16 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) AT4G19640 67 / 7e-15 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) AT4G17160 66 / 5e-14 AtRab2B, AtRABB1a RAB GTPase homolog B1A (.1) AT4G17170 63 / 4e-13 ATRAB-B1B, AT-RAB2, AtRABB1c, AtRab2A ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) AT3G54840 63 / 5e-13 ARA6, AtRABF1, Ara-6, AtRab5C Ras-related small GTP-binding family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019501 [exp] 201 / 3e-67 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10043349 [exp] 201 / 3e-67 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10041702 [exp] 183 / 5e-60 AT5G10260 404 / 7e-146 RAB GTPase homolog H1E (.1) Lus10014336 [exp] 181 / 3e-59 AT5G10260 402 / 3e-145 RAB GTPase homolog H1E (.1) Lus10024046 [exp] 182 / 1e-58 AT5G10260 405 / 3e-145 RAB GTPase homolog H1E (.1) Lus10026045 [exp] 108 / 2e-31 AT5G10260 209 / 5e-70 RAB GTPase homolog H1E (.1) Lus10034903 [exp] 69 / 3e-15 AT5G45130 258 / 2e-88 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10038334 [exp] 64 / 1e-13 AT5G45130 349 / 3e-124 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10038744 [exp] 64 / 2e-13 AT4G17170 434 / 2e-157 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G135500 [exp] 189 / 3e-62 AT2G44610 385 / 3e-138 Ras-related small GTP-binding family protein (.1) Potri.003G086700 [exp] 187 / 2e-61 AT2G44610 397 / 4e-143 Ras-related small GTP-binding family protein (.1) Potri.005G075300 [exp] 182 / 1e-59 AT5G10260 400 / 2e-144 RAB GTPase homolog H1E (.1) Potri.001G147900 [exp] 131 / 2e-39 AT2G44610 298 / 2e-103 Ras-related small GTP-binding family protein (.1) Potri.012G117800 [exp] 69 / 2e-15 AT5G45130 357 / 1e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.018G079300 [exp] 67 / 1e-14 AT5G45130 273 / 2e-94 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.016G002200 [exp] 64 / 2e-13 AT4G17170 394 / 6e-142 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Potri.015G113000 [exp] 62 / 6e-13 AT5G45130 339 / 2e-120 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.010G226300 [exp] 62 / 1e-12 AT3G54840 373 / 7e-134 Ras-related small GTP-binding family protein (.1.2) Potri.008G035800 [exp] 61 / 3e-12 AT3G54840 367 / 3e-131 Ras-related small GTP-binding family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10019502 pacid=23181547 polypeptide=Lus10019502 locus=Lus10019502.g ID=Lus10019502.BGIv1.0 annot-version=v1.0 ATGGCTGGCAGACATTCGTTTCTGAACACATCCAAATGGATTGAAGAGGTTCGCACTGAGCGGGGAAGTGATGTCATAATTGTACTGGTCGGAAATAAGA CTGATCTTGTTGACAAAAGGCAAGTTTCAGTAGAGGAAGGAGAGGCAAAAGCTCGTGAGATGAATGTCATGTGTATCGAGACAAGTGCAAAGGCTGGCTT CAATATTAAGGCGCTGTTCAGGAAGATTGCAGCAGCACTGCCGGGAATGGAAACACTTTCATCAACGAAGCAAGAAGATATGGTTGATGTGAATCTCAAG TCCTCAAATGCTAATGCATCACAGTCCCAAGGGCAGTCAGGAGGATGTGCTTGTTGA
AA sequence Show only first row Show all	>Lus10019502 pacid=23181547 polypeptide=Lus10019502 locus=Lus10019502.g ID=Lus10019502.BGIv1.0 annot-version=v1.0 MAGRHSFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSVEEGEAKAREMNVMCIETSAKAGFNIKALFRKIAAALPGMETLSSTKQEDMVDVNLK SSNANASQSQGQSGGCAC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G44610		RAB6, AtRABH1b,...	Ras-related small GTP-binding ...		Lus10019502 [exp]	0	1
AT2G44610		RAB6, AtRABH1b,...	Ras-related small GTP-binding ...		Lus10019501 [exp]	3.5	0.8068
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10040611 [exp]	4.5	0.7573
AT2G36900		ATMEMB11, MEMB1...	membrin 11 (.1.2)		Lus10020302 [exp]	7.2	0.7900
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Lus10000044 [exp]	11.7	0.7546
AT2G24765		ARF3, ARL1, ATA...	ARF-LIKE 1, ADP-ribosylation f...		Lus10026910 [exp]	14.8	0.7240
AT1G17455		ELF4-L4	ELF4-like 4 (.1.2)		Lus10000371 [exp]	19.8	0.7574
AT4G26055			unknown protein		Lus10011865 [exp]	22.0	0.6460
AT3G08890			Protein of unknown function, D...		Lus10012232 [exp]	24.3	0.7584
AT5G47200		AtRABD2b, AtRab...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10004361 [exp]	25.0	0.7050
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Lus10008135 [exp]	25.7	0.6666

Compare expression of checked genes

Lus10019502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.